1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin D
  5. Cystatin D/CST5 Protein, Human (HEK293, His)

Cystatin D/CST5 Protein, Human (HEK293, His)

Cat. No.: HY-P70020
Handling Instructions Technical Support

Cystatin D (CST5), a cysteine proteinase inhibitor, potentially safeguards against oral cavity proteinases. Exhibiting specificity, it preferentially inhibits cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This nuanced regulation emphasizes Cystatin D's role in modulating specific cysteine proteinases, signifying its importance in proteostasis and potential involvement in oral health. Cystatin D/CST5 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin D/CST5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin D/CST5 Protein, Human (HEK293, His) is 122 a.a., with molecular weight of ~15.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin D (CST5), a cysteine proteinase inhibitor, potentially safeguards against oral cavity proteinases. Exhibiting specificity, it preferentially inhibits cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This nuanced regulation emphasizes Cystatin D's role in modulating specific cysteine proteinases, signifying its importance in proteostasis and potential involvement in oral health. Cystatin D/CST5 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin D/CST5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin D/CST5 Protein, Human (HEK293, His) is 122 a.a., with molecular weight of ~15.0 kDa.

Background

Cystatin D (CST5), a cysteine proteinase inhibitor, is believed to serve a potential protective function against proteinases found in the oral cavity. Exhibiting specificity in its inhibitory activity, Cystatin D shows a preference order for inhibition against cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This suggests a nuanced regulatory role of Cystatin D in modulating the activities of specific cysteine proteinases, highlighting its significance in maintaining proteostasis and potential involvement in oral health.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P28325 (G21-V142)

Gene ID
Molecular Construction
N-term
CST5 (G21-V142)
Accession # P28325
6*His
C-term
Synonyms
rHuCystatin-D/CST5, His; Cystatin-D; Cystatin-5; CST5
AA Sequence

GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV

Molecular Weight

Approximately 15.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cystatin D/CST5 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin D/CST5 Protein, Human (HEK293, His)
Cat. No.:
HY-P70020
Quantity:
MCE Japan Authorized Agent: