Cystatin D/CST5 Protein, Human (HEK293, His)

Cystatin D (CST5), a cysteine proteinase inhibitor, potentially safeguards against oral cavity proteinases. Exhibiting specificity, it preferentially inhibits cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This nuanced regulation emphasizes Cystatin D's role in modulating specific cysteine proteinases, signifying its importance in proteostasis and potential involvement in oral health. Cystatin D/CST5 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin D/CST5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Cystatin D/CST5 Protein, Human (HEK293, His) is 122 a.a., with molecular weight of ~15.0 kDa.

Cystatin D (CST5), a cysteine proteinase inhibitor, is believed to serve a potential protective function against proteinases found in the oral cavity. Exhibiting specificity in its inhibitory activity, Cystatin D shows a preference order for inhibition against cathepsin S, cathepsin H, cathepsin L, and cathepsin B. This suggests a nuanced regulatory role of Cystatin D in modulating the activities of specific cysteine proteinases, highlighting its significance in maintaining proteostasis and potential involvement in oral health.

Human

HEK293

C-6*His

P28325 (G21-V142)

1473  [NCBI]

GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.