Cytochrome b5/CYB5A Protein, Human (His)

Cytochrome b5 (CYB5A) is a vital membrane-bound hemoprotein acting as an electron carrier for diverse membrane-bound oxygenases. Positioned in cellular membranes, it crucially facilitates electron transfer processes, supporting the activity of oxygenase enzymes. CYB5A's role as an electron carrier highlights its significance in cellular redox reactions and metabolic pathways involving oxygenases. Cytochrome b5/CYB5A Protein, Human (His) is the recombinant human-derived Cytochrome b5/CYB5A protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cytochrome b5/CYB5A Protein, Human (His) is 134 a.a., with molecular weight of ~17.0 kDa.

Cytochrome b5 (CYB5A) is a membrane-bound hemoprotein that serves as an electron carrier for various membrane-bound oxygenases. Positioned within cellular membranes, this protein plays a crucial role in facilitating electron transfer processes, contributing to the activity of oxygenase enzymes. Its function as an electron carrier underscores its significance in cellular redox reactions and metabolic pathways where oxygenases are involved.

Human

E. coli

N-6*His

P00167 (M1-D134)

1528  [NCBI]

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

Approximately 17.0 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.