1. Recombinant Proteins
  2. Others
  3. Cytochrome b5/CYB5A Protein, Human (His)

Cytochrome b5 (CYB5A) is a vital membrane-bound hemoprotein acting as an electron carrier for diverse membrane-bound oxygenases. Positioned in cellular membranes, it crucially facilitates electron transfer processes, supporting the activity of oxygenase enzymes. CYB5A's role as an electron carrier highlights its significance in cellular redox reactions and metabolic pathways involving oxygenases. Cytochrome b5/CYB5A Protein, Human (His) is the recombinant human-derived Cytochrome b5/CYB5A protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cytochrome b5/CYB5A Protein, Human (His) is 134 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cytochrome b5 (CYB5A) is a vital membrane-bound hemoprotein acting as an electron carrier for diverse membrane-bound oxygenases. Positioned in cellular membranes, it crucially facilitates electron transfer processes, supporting the activity of oxygenase enzymes. CYB5A's role as an electron carrier highlights its significance in cellular redox reactions and metabolic pathways involving oxygenases. Cytochrome b5/CYB5A Protein, Human (His) is the recombinant human-derived Cytochrome b5/CYB5A protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cytochrome b5/CYB5A Protein, Human (His) is 134 a.a., with molecular weight of ~17.0 kDa.

Background

Cytochrome b5 (CYB5A) is a membrane-bound hemoprotein that serves as an electron carrier for various membrane-bound oxygenases. Positioned within cellular membranes, this protein plays a crucial role in facilitating electron transfer processes, contributing to the activity of oxygenase enzymes. Its function as an electron carrier underscores its significance in cellular redox reactions and metabolic pathways where oxygenases are involved.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P00167 (M1-D134)

Gene ID
Molecular Construction
N-term
6*His
CYB5A (M1-D134)
Accession # P00167
C-term
Synonyms
rHuCytochrome b5/CYB5A, His; Cytochrome b5; Microsomal Cytochrome b5 Type A; MCB5; CYB5A; CYB5
AA Sequence

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cytochrome b5/CYB5A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cytochrome b5/CYB5A Protein, Human (His)
Cat. No.:
HY-P7858
Quantity:
MCE Japan Authorized Agent: