Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His)

The Der p 23 protein was identified as a member of the allergic house dust mite proteins and does not exhibit chitin-binding ability in vitro. This unique feature distinguishes Der p 23 from other proteins known for their affinity to chitin, emphasizing its unique properties. Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His) is the recombinant Der p 23 protein, expressed by HEK293 , with C-His labeled tag. The total length of Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His) is 69 a.a., with molecular weight of ~19 kDa.

Der p 23 protein, as indicated by available information, does not exhibit chitin-binding activity in vitro. Chitin is a polysaccharide often associated with the exoskeletons of insects and the cell walls of fungi, and the absence of chitin binding in Der p 23 suggests a unique functional profile. Additionally, Der p 23 is described as a monomeric protein, implying that it exists as a single, independent unit rather than forming complexes with other molecules. Understanding these characteristics is crucial for unraveling the biological role of Der p 23, particularly in the context of its interactions with environmental factors, and further research is needed to delineate the specific functions and implications of this protein within relevant physiological contexts. (

Others

HEK293

C-His

L7N6F8 (A22-T90)

113788516  [NCBI]

ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT

Approximately 19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.