1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Platelet CD Proteins
  4. DNAM-1/CD226 DNAM-1/CD226
  5. DNAM-1 Protein, Rat (HEK293, His)

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DNAM-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DNAM-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The DNAM-1 protein is intricately involved in intercellular adhesion, lymphocyte signaling, cytotoxicity, and lymphokine secretion mediated by cytotoxic T-lymphocytes (CTL) and natural killer (NK) cells. Serving as a cell surface receptor for NECTIN2, DNAM-1, upon ligand binding, stimulates T-cell proliferation and the production of cytokines such as IL2, IL5, IL10, IL13, and IFNG. Furthermore, DNAM-1 competes with PVRIG for NECTIN2-binding, underscoring its regulatory role in cellular interactions and signaling pathways. This protein also interacts with PVR and NECTIN2, contributing to its multifaceted functions in immune responses and cellular communication.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat DNAM-1 at 1 μg/mL (100 μL/well) can bind biotinylated CD155 Protein. The ED50 for this effect is 7.119 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat DNAM-1 at 1μg/mL (100 μL/well) can bind biotinylated CD155 Protein. The ED50 for this effect is 7.119 ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

D3ZS97 (E32-I265)

Gene ID
Molecular Construction
N-term
DNAM-1 (E32-I265)
Accession # D3ZS97
His
C-term
Synonyms
CD226 antigen; DNAX accessory molecule 1; DNAM-1; CD226
AA Sequence

EETLWDTTVRLSETMTLECVYPLTDNLTQAEWTKDTGTKKVNIAVYHPNHNMHIDPNYLHRVHFQNATVGFRNMSLSFYNASEADIGIYTCLFHAFPRGSWEKKIKVVQSDSFETTAPLDSYLSAEPGQNVTLSCQLERTWLVQLVIWEKVQPHQVDILASCNLSQGTRYTSKYLRQTWSDCSQESMKSALIIPYAMAADSGLYRCRSEASTGTNKTCVIRLIITDGGTNNHFI

Molecular Weight

Approximately 28 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DNAM-1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DNAM-1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76213
Quantity:
MCE Japan Authorized Agent: