DNASE1L3 Protein, Human (GST)

DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (GST) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with N-GST labeled tag. The total length of DNASE1L3 Protein, Human (GST) is 285 a.a., with molecular weight of ~60.4 kDa.

DNASE1L3 protein possesses DNA hydrolytic activity, demonstrating proficiency in both single- and double-stranded DNA cleavage, resulting in the production of DNA fragments with 3'-OH ends. The protein can cleave chromatin to nucleosomal units and exhibits activity on nucleosomal and liposome-coated DNA. It plays a crucial role in internucleosomal DNA fragmentation during apoptosis and necrosis, contributing to processes such as myogenic and neuronal differentiation, as well as BCR-mediated clonal deletion of self-reactive B cells. DNASE1L3 is active on chromatin in apoptotic cell-derived membrane-coated microparticles, thereby suppressing anti-DNA autoimmunity. Additionally, in collaboration with DNASE1, DNASE1L3 is essential for degrading neutrophil extracellular traps (NETs), composed mainly of DNA fibers released by neutrophils during inflammation. The degradation of intravascular NETs by DNASE1 and DNASE1L3 is crucial to prevent the formation of clots that could obstruct blood vessels and lead to organ damage following inflammation.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-GST

Q13609 (M21-S305)

1776  [NCBI]

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Approximately 60.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.