EDAR Protein, Cynomolgus (HEK293, His)

EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDAR protein, expressed by HEK293 , with C-His labeled tag.

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED₅₀ for this effect is 473.9 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED₅₀ for this effect is 473.9 ng/mL.

Cynomolgus

HEK293

C-6*His

A0A2K5VY41 (E27-A187)

102120238  [NCBI]

EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPLQHAHKELSGQGHLATA

Approximately 17-23 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.