1. Recombinant Proteins
  2. Others
  3. EDF1/MBF1 Protein, Human (His)

EDF1/MBF1 Protein, Human (His)

Cat. No.: HY-P70209
Handling Instructions

The EDF1/MBF1 protein is a transcriptional coactivator that stimulates NR5A1, NR1H3/LXRA, and PPARG transcriptional activity. It enhances ATF1, ATF2, CREB1 and NR5A1 DNA binding. EDF1/MBF1 Protein, Human (His) is the recombinant human-derived EDF1/MBF1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of EDF1/MBF1 Protein, Human (His) is 147 a.a., with molecular weight of 16 & 40 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EDF1/MBF1 protein is a transcriptional coactivator that stimulates NR5A1, NR1H3/LXRA, and PPARG transcriptional activity. It enhances ATF1, ATF2, CREB1 and NR5A1 DNA binding. EDF1/MBF1 Protein, Human (His) is the recombinant human-derived EDF1/MBF1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of EDF1/MBF1 Protein, Human (His) is 147 a.a., with molecular weight of 16 & 40 kDa, respectively.

Background

EDF1/MBF1, a transcriptional coactivator, stimulates the transcriptional activities of NR5A1 and ligand-dependent NR1H3/LXRA and PPARG. It plays a pivotal role in enhancing the DNA-binding activity of ATF1, ATF2, CREB1, and NR5A1. Additionally, EDF1/MBF1 is implicated in the regulation of nitric oxide synthase activity, potentially by sequestering calmodulin in the cytoplasm. Its diverse functions extend to endothelial cell differentiation, hormone-induced cardiomyocyte hypertrophy, and lipid metabolism. EDF1/MBF1 interacts with key players in transcriptional regulation, such as TBP and the TFIID complex, NR5A2, NR1H3, and PPARG. The interaction with TBP is subject to regulation through phosphorylation. Furthermore, EDF1/MBF1 binds to NR5A1, ATF1, FOS, and JUN through their conserved basic regions, and its binding to calmodulin is modulated by calcium levels and IQ motif phosphorylation.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O60869 (A2-K148)

Gene ID
Molecular Construction
N-term
EDF1 (A2-K148)
Accession # O60869
6*His
C-term
Synonyms
rHuEndothelial differentiation-related factor 1/EDF1, His; Endothelial Differentiation-Related Factor 1; EDF-1; Multiprotein-Bridging Factor 1; MBF1; EDF1
AA Sequence

AESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Molecular Weight

16&40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EDF1/MBF1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EDF1/MBF1 Protein, Human (His)
Cat. No.:
HY-P70209
Quantity:
MCE Japan Authorized Agent: