EDF1/MBF1 Protein, Human (His)

The EDF1/MBF1 protein is a transcriptional coactivator that stimulates NR5A1, NR1H3/LXRA, and PPARG transcriptional activity. It enhances ATF1, ATF2, CREB1 and NR5A1 DNA binding. EDF1/MBF1 Protein, Human (His) is the recombinant human-derived EDF1/MBF1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of EDF1/MBF1 Protein, Human (His) is 147 a.a., with molecular weight of 16 & 40 kDa, respectively.

EDF1/MBF1, a transcriptional coactivator, stimulates the transcriptional activities of NR5A1 and ligand-dependent NR1H3/LXRA and PPARG. It plays a pivotal role in enhancing the DNA-binding activity of ATF1, ATF2, CREB1, and NR5A1. Additionally, EDF1/MBF1 is implicated in the regulation of nitric oxide synthase activity, potentially by sequestering calmodulin in the cytoplasm. Its diverse functions extend to endothelial cell differentiation, hormone-induced cardiomyocyte hypertrophy, and lipid metabolism. EDF1/MBF1 interacts with key players in transcriptional regulation, such as TBP and the TFIID complex, NR5A2, NR1H3, and PPARG. The interaction with TBP is subject to regulation through phosphorylation. Furthermore, EDF1/MBF1 binds to NR5A1, ATF1, FOS, and JUN through their conserved basic regions, and its binding to calmodulin is modulated by calcium levels and IQ motif phosphorylation.

Human

E. coli

C-6*His

O60869 (A2-K148)

8721  [NCBI]

AESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

16&40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.