EGF Protein, Canine (His)

The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (His) is the recombinant canine-derived EGF protein, expressed by E. coli , with N-His labeled tag. The total length of EGF Protein, Canine (His) is 52 a.a., with molecular weight of 16-22 kDa.

Epidermal Growth Factor (EGF) is a potent stimulator of growth for various epidermal and epithelial tissues both in vivo and in vitro, as well as some fibroblasts in cell culture. This multifunctional protein plays a vital role in cellular processes, particularly in promoting the proliferation and development of tissues. Beyond its role in tissue growth, EGF acts as a magnesiotropic hormone, facilitating magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Additionally, EGF interacts with EGFR, promoting EGFR dimerization, and engages with RHBDF1 and RHBDF2, potentially influencing EGF's intracellular trafficking and degradation pathways. These interactions underline the complex and versatile functions of EGF in both growth and signaling processes within the cell.

Immobilized Canine EGF, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human EGFR, hFc Tag with the EC₅₀ of 4.7 ng/mL determined by ELISA.

Canine

E. coli

N-His

Q9BEA0 (N973-R1024)

403657  [NCBI]

NGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELR

16-22 kDa

Greater than 95% as determined by reducing SDS-PAGE or Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.