EGFR vIII Protein, Human (Biotinylated, HEK293, His-Avi)

The EGFRvIII protein is a transmembrane glycoprotein in the protein kinase superfamily that acts as a receptor for epidermal growth factor. It acts on the cell surface, binds to epidermal growth factor, triggers receptor dimerization and tyrosine autophosphorylation, and promotes cell proliferation. EGFR vIII Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived EGFR vIII protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of EGFR vIII Protein, Human (Biotinylated, HEK293, His-Avi) is 354 a.a., with molecular weight of 65-80 kDa.

The EGFRvIII protein is a transmembrane glycoprotein belonging to the protein kinase superfamily and serves as a receptor for members of the epidermal growth factor family. Operating as a cell surface protein, EGFRvIII binds to epidermal growth factor, initiating receptor dimerization and tyrosine autophosphorylation, thereby promoting cell proliferation. Mutations in this gene are associated with lung cancer. Furthermore, EGFRvIII is implicated as a component of the cytokine storm, contributing to the severity of Coronavirus Disease 2019 (COVID-19) caused by infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). [provided by RefSeq, Jul 2020]

1.Immobilized Biotinylated Human EGFR vIII His at 0.5 μg/mL (100μL/Well) on the plate. Dose response curve for Anti-EGFR vIII Antibody hFc with the EC₅₀ < 20 ng/mL determined by ELISA.
2.Loaded Anti-Human EGFR mAb on Pro-A Biosensor, can bind EGFR vIII Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 3.64 nM as determined in BLI assay. 

Human

HEK293

C-Avi;C-His

NP_001333870 (L25-S378)

1956  [NCBI]

LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS

65-80 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.