EGR1/ZNF225 Protein, Human (His)

The EGR1/ZNF225 protein is a multifunctional transcriptional regulator that binds to the EGR site in the promoter of target genes and is independent of cytosine methylation. It controls the transcription of multiple target genes, affecting responses to growth factors, DNA damage, and ischemia. EGR1/ZNF225 Protein, Human (His) is the recombinant human-derived EGR1/ZNF225 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EGR1/ZNF225 Protein, Human (His) is 152 a.a., with molecular weight of ~20.0 kDa.

EGR1/ZNF225, a transcriptional regulator, exhibits a versatile role in the cell, recognizing and binding to the DNA sequence 5'-GCG(T/G)GGGCG-3' (EGR-site) within target gene promoters. Regardless of cytosine methylation status, it binds double-stranded target DNA. Functionally, EGR1/ZNF225 governs the transcription of numerous target genes, playing a crucial role in modulating responses to growth factors, DNA damage, and ischemia. It contributes to the intricate balance of cell survival, proliferation, and death, activating the expression of key regulators like p53/TP53 and TGFB1 to prevent tumor formation. Essential for mitotic progress and hepatocyte proliferation after partial hepatectomy, EGR1/ZNF225 also mediates responses to ischemia and hypoxia, influencing the expression of inflammatory proteins such as IL1B and CXCL2. Moreover, it participates in the regulation of luteinizing hormone biosynthesis in the pituitary. Additionally, EGR1/ZNF225 orchestrates the rhythmic expression of clock genes like BMAL1, PER2, and NR1D1 in the liver, impacting circadian rhythms. Its dynamic interactions with SNAI1 and SP1 under 12-O-tetradecanoylphorbol-13-acetate (TPA) induction add further complexity to its regulatory network.

Human

E. coli

N-6*His

P18146 (Q282-S433)

1958  [NCBI]

QQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS

Approximately 20.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.