1. Recombinant Proteins
  2. Others
  3. EGR1/ZNF225 Protein, Human (His)

The EGR1/ZNF225 protein is a multifunctional transcriptional regulator that binds to the EGR site in the promoter of target genes and is independent of cytosine methylation. It controls the transcription of multiple target genes, affecting responses to growth factors, DNA damage, and ischemia. EGR1/ZNF225 Protein, Human (His) is the recombinant human-derived EGR1/ZNF225 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EGR1/ZNF225 Protein, Human (His) is 152 a.a., with molecular weight of ~20.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE EGR1/ZNF225 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EGR1/ZNF225 protein is a multifunctional transcriptional regulator that binds to the EGR site in the promoter of target genes and is independent of cytosine methylation. It controls the transcription of multiple target genes, affecting responses to growth factors, DNA damage, and ischemia. EGR1/ZNF225 Protein, Human (His) is the recombinant human-derived EGR1/ZNF225 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EGR1/ZNF225 Protein, Human (His) is 152 a.a., with molecular weight of ~20.0 kDa.

Background

EGR1/ZNF225, a transcriptional regulator, exhibits a versatile role in the cell, recognizing and binding to the DNA sequence 5'-GCG(T/G)GGGCG-3' (EGR-site) within target gene promoters. Regardless of cytosine methylation status, it binds double-stranded target DNA. Functionally, EGR1/ZNF225 governs the transcription of numerous target genes, playing a crucial role in modulating responses to growth factors, DNA damage, and ischemia. It contributes to the intricate balance of cell survival, proliferation, and death, activating the expression of key regulators like p53/TP53 and TGFB1 to prevent tumor formation. Essential for mitotic progress and hepatocyte proliferation after partial hepatectomy, EGR1/ZNF225 also mediates responses to ischemia and hypoxia, influencing the expression of inflammatory proteins such as IL1B and CXCL2. Moreover, it participates in the regulation of luteinizing hormone biosynthesis in the pituitary. Additionally, EGR1/ZNF225 orchestrates the rhythmic expression of clock genes like BMAL1, PER2, and NR1D1 in the liver, impacting circadian rhythms. Its dynamic interactions with SNAI1 and SP1 under 12-O-tetradecanoylphorbol-13-acetate (TPA) induction add further complexity to its regulatory network.

Biological Activity

Measured by its ability to down regulate the expression of TNF-α in THP-1 cells treated with LPS.

  • Measured by its ability to down regulate the expression of TNF-α in THP-1 cells treated with LPS.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P18146 (Q282-S433)

Gene ID
Molecular Construction
N-term
6*His
EGR1 (Q282-S433)
Accession # P18146
C-term
Synonyms
rHuEarly growth response protein 1/EGR1, His; EGR-1; Early growth response protein 1; Zif268; zinc finger protein 225; NGFI-A ; nerve growth factor-induced protein A;
AA Sequence

QQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS

Molecular Weight

Approximately 20.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EGR1/ZNF225 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGR1/ZNF225 Protein, Human (His)
Cat. No.:
HY-P70310
Quantity:
MCE Japan Authorized Agent: