EIF4EBP1 Protein, Human (His)

EIF4EBP1 is a translation initiation repressor protein that complexly regulates EIF4E activity. In the hypophosphorylated state, EIF4EBP1 competes with EIF4G1/EIF4G3 to inhibit translation by binding to EIF4E. EIF4EBP1 Protein, Human (His) is the recombinant human-derived EIF4EBP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF4EBP1 Protein, Human (His) is 118 a.a., with molecular weight of ~17.0 kDa.

EIF4EBP1, a translation initiation repressor, intricately regulates EIF4E activity by modulating its association with the eIF4F complex. In its hypophosphorylated state, EIF4EBP1 competes robustly with EIF4G1/EIF4G3 for binding to EIF4E, leading to the repression of translation. Conversely, the hyperphosphorylated form dissociates from EIF4E, facilitating the interaction between EIF4G1/EIF4G3 and EIF4E, thereby initiating translation. Functioning as a key mediator in the regulation of protein translation, EIF4EBP1 responds to signals from hormones, growth factors, and stimuli acting through the MAP kinase and mTORC1 pathways. The interplay between insulin-stimulated MAP-kinase or mTORC1 phosphorylation events and EIF4EBP1 dynamics underscores its role in finely tuning cellular responses to diverse signaling cues. Additionally, EIF4EBP1's interaction with RPTOR, particularly via the TOS motif, further highlights its involvement in mTORC1-mediated phosphorylation processes.

Human

E. coli

N-6*His

Q13541 (M1-I118)

1978  [NCBI]

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Approximately 17.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.