1. Recombinant Proteins
  2. Others
  3. EIF4EBP1 Protein, Human (His)

EIF4EBP1 is a translation initiation repressor protein that complexly regulates EIF4E activity. In the hypophosphorylated state, EIF4EBP1 competes with EIF4G1/EIF4G3 to inhibit translation by binding to EIF4E. EIF4EBP1 Protein, Human (His) is the recombinant human-derived EIF4EBP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF4EBP1 Protein, Human (His) is 118 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EIF4EBP1 is a translation initiation repressor protein that complexly regulates EIF4E activity. In the hypophosphorylated state, EIF4EBP1 competes with EIF4G1/EIF4G3 to inhibit translation by binding to EIF4E. EIF4EBP1 Protein, Human (His) is the recombinant human-derived EIF4EBP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF4EBP1 Protein, Human (His) is 118 a.a., with molecular weight of ~17.0 kDa.

Background

EIF4EBP1, a translation initiation repressor, intricately regulates EIF4E activity by modulating its association with the eIF4F complex. In its hypophosphorylated state, EIF4EBP1 competes robustly with EIF4G1/EIF4G3 for binding to EIF4E, leading to the repression of translation. Conversely, the hyperphosphorylated form dissociates from EIF4E, facilitating the interaction between EIF4G1/EIF4G3 and EIF4E, thereby initiating translation. Functioning as a key mediator in the regulation of protein translation, EIF4EBP1 responds to signals from hormones, growth factors, and stimuli acting through the MAP kinase and mTORC1 pathways. The interplay between insulin-stimulated MAP-kinase or mTORC1 phosphorylation events and EIF4EBP1 dynamics underscores its role in finely tuning cellular responses to diverse signaling cues. Additionally, EIF4EBP1's interaction with RPTOR, particularly via the TOS motif, further highlights its involvement in mTORC1-mediated phosphorylation processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q13541 (M1-I118)

Gene ID
Molecular Construction
N-term
6*His
EIF4EBP1 (M1-I118)
Accession # Q13541
C-term
Synonyms
rHuEukaryotic translation initiation factor 4E-binding protein 1/EIF4EBP1, His; Eukaryotic Translation Initiation Factor 4E-Binding Protein 1; 4E-BP1; eIF4E-Binding Protein 1; Phosphorylated Heat- and Acid-Stable Protein Regulated by Insulin 1; PHAS-I; EIF4EBP1
AA Sequence

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

EIF4EBP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF4EBP1 Protein, Human (His)
Cat. No.:
HY-P70415
Quantity:
MCE Japan Authorized Agent: