EphA3 Protein, Human (HEK293, His)

The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Human (HEK293, His) is the recombinant human-derived EphA3 protein, expressed by HEK293 , with C-6*His labeled tag.

The EphA3 protein, a receptor tyrosine kinase, engages in promiscuous binding to membrane-bound ephrin family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the pathway downstream of the ephrin ligand is termed reverse signaling. Highly promiscuous for ephrin-A ligands, EphA3 exhibits a preferential binding affinity for EFNA5. Upon activation by EFNA5, EphA3 plays a pivotal role in regulating cell-cell adhesion, cytoskeletal organization, and cell migration. Additionally, EphA3 is implicated in cardiac cell migration and differentiation, regulating the formation of the atrioventricular canal and septum during development, likely through activation by EFNA1. In the context of retinotectal mapping, EphA3 is involved in the guidance of neurons. Furthermore, EphA3 may control the segregation, though not the guidance, of motor and sensory axons during neuromuscular circuit development.

1.Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 0.2 μg/well can bind human EFNA5, the EC₅₀ of the protein is 0.4157-1.179 ng/mL.
2.Human EPHA3 protein his tag captured on COOH chip can bind Human EFNA5 protein Fc tag with an affinity constant of 13.8 nM as detected by LSPR Assay.

Human

HEK293

C-6*His

P29320-1 (E21-Q541)

2042  [NCBI]

ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ

Approximately 67.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.