EphA6 Protein, Mouse (HEK293, His)

EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA6 protein, expressed by HEK293 , with C-His labeled tag. The total length of EphA6 Protein, Mouse (HEK293, His) is 524 a.a., with molecular weight of ~65-70 kDa.

The EphA6 protein, a receptor tyrosine kinase, exhibits promiscuous binding to GPI-anchored ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. The downstream pathway originating from the receptor is termed forward signaling, while the pathway downstream of the ephrin ligand is referred to as reverse signaling, as indicated by similarity to other Eph receptors. This interaction highlights EphA6's role in mediating intricate signaling exchanges between cells, contributing to diverse cellular processes through bidirectional communication.

Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphA6 at 2 μg/mL(100 μL/well) can bind biotinylated recombinant mouse EphrinA3. The ED₅₀ for this effect is 42.95 ng/mL.

• 
  Measured by its binding ability in a functional ELISA.Immobilized recombinant mouse EphA6 at 2 μg/mL (100 μL/well) can bind biotinylated recombinant mouse EphrinA3 .The ED₅₀ for this effect is 42.95 ng/mL.

Mouse

HEK293

C-His

Q62413 (W23-Q546)

13840  [NCBI]

WTGDCSHVSNQVVLLDTTTVMGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLYYIESDESHGTKFKPSQYIKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSSTYVEATSVCHCEKGYFRAEKDPPSMACTRPPSAPRNVAFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTTQCEDCGGGLRFIPRHTGLINNSVVVLDFVSHVNYTFEIEAMNGVSELSISPKPFTAITVTTDHDAPSLIGMMRKDWASQNSLALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIVTGLKPATTYIFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQ

Approximately 65-70 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.