1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. Ephrin/Eph Family Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. Eph Receptors
  5. EphA7
  6. EphA7 Protein, Human (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that promiscuously binds to the GPI-anchored ephrin-A ligand to initiate bidirectional signaling. It participates in forward and reverse signaling pathways, uses EFNA5 as a functional ligand, regulates brain development and affects cell adhesion and repulsion. EphA7 Protein, Human (HEK293, His) is the recombinant human-derived EphA7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EphA7 protein is a receptor tyrosine kinase that promiscuously binds to the GPI-anchored ephrin-A ligand to initiate bidirectional signaling. It participates in forward and reverse signaling pathways, uses EFNA5 as a functional ligand, regulates brain development and affects cell adhesion and repulsion. EphA7 Protein, Human (HEK293, His) is the recombinant human-derived EphA7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The EphA7 protein, a receptor tyrosine kinase, engages in promiscuous binding to GPI-anchored ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is termed forward signaling, while the pathway downstream of the ephrin ligand is referred to as reverse signaling. Among the GPI-anchored ephrin-A ligands, EFNA5 serves as a cognate/functional ligand for EPHA7, regulating brain development and modulating cell-cell adhesion and repulsion. EphA7 exhibits repellent activity on axons, playing a crucial role in guiding corticothalamic axons and ensuring the proper topographic mapping of retinal axons to the colliculus. Additionally, EphA7 may contribute to brain development through a caspase (CASP3)-dependent proapoptotic activity. Forward signaling through EphA7 may result in the activation of components of the ERK signaling pathway, including MAP2K1, MAP2K2, MAPK1, and MAPK3, which are phosphorylated upon EphA7 activation.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q15375-1 (Q28-I556)

Gene ID
Molecular Construction
N-term
EphA7 (Q28-I556)
Accession # Q15375-1
6*His
C-term
Synonyms
Ephrin Type-A Receptor 7; EPH Homology Kinase 3; EHK-3; EPH-Like Kinase 11; EK11; hEK11; EPHA7; EHK3; HEK11
AA Sequence

QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVI

Molecular Weight

Approximately 72.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EphA7 Protein, Human (HEK293, His)
Cat. No.:
HY-P70842
Quantity:
MCE Japan Authorized Agent: