1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A4
  6. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, Fc)

Ephrin-A4/EFNA4 proteins are cell surface GPI-binding ligands of Eph receptors that serve as critical mediators in a variety of cellular processes critical for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A4 binds to Eph receptors on neighboring cells, stimulating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A4/EFNA4 proteins are cell surface GPI-binding ligands of Eph receptors that serve as critical mediators in a variety of cellular processes critical for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A4 binds to Eph receptors on neighboring cells, stimulating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Ephrin-A4 (EFNA4) is a cell surface glycosylphosphatidylinositol (GPI)-bound ligand that belongs to the Eph receptor family, a group of receptor tyrosine kinases crucial for various developmental processes, including migration, repulsion, and adhesion in neurons, vascular tissues, and epithelial cells. EFNA4 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. This interaction is essential for orchestrating complex cellular events during development. Moreover, EFNA4 may contribute to the interaction between activated B-lymphocytes and dendritic cells in tonsils, suggesting its involvement in immune responses.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

O08542 (R27-G176)

Gene ID
Molecular Construction
N-term
EFNA4 (R27-G176)
Accession # O08542
hFc
C-term
Synonyms
rMuEphrin-A4, Fc; Ephrin-A4 ; EPH-related receptor tyrosine kinase ligand 4 ; Epl4; Eplg4; Lerk4
AA Sequence

RHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESG

Molecular Weight

Approximately 53.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin-A4/EFNA4 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A4/EFNA4 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70193
Quantity:
MCE Japan Authorized Agent: