1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A5
  6. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His)

Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76322
Handling Instructions Technical Support

Ephrin-A5 (EFNA5) is a member of the ephrin family. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) is 183 a.a., with molecular weight of ~27 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A5 (EFNA5) is a member of the ephrin family. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) is 183 a.a., with molecular weight of ~27 KDa.

Background

Ephrin-A5, also referred to as EFNA5, is a member of the ephrin family of proteins that play pivotal roles in mediating cell-to-cell communication and tissue development. As a transmembrane protein, Ephrin-A5 functions as both a ligand and a receptor, engaging in bidirectional signaling interactions with Eph receptors on adjacent cells. This interaction initiates a cascade of intracellular events that modulate various cellular processes, including cell adhesion, repulsion, and migration. Ephrin-A5 is particularly implicated in neuronal development, where it contributes to axon guidance and synaptic plasticity. Additionally, it plays a role in angiogenesis, influencing vascular development. The diverse functions of Ephrin-A5 underscore its significance in orchestrating complex cellular behaviors and highlight its involvement in various physiological and pathological processes. Gaining insights into the molecular mechanisms governed by Ephrin-A5 is crucial for understanding its potential implications in neurological disorders, developmental biology, and other medical contexts.

Biological Activity

Immobilized Rhesus Macaque EFNA5 at 10 μg/mL (100 μL/well) can bind Mouse EPHA3. The ED50 for this effect is 146.7 ng/mL.

  • Immobilized Rhesus Macaque EFNA5 at 10 μg/mlL (100 μL/well) can bind Mouse EPHA3. The ED50 for this effect is 146.7 ng/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

F7GZC7 (Q21-N203)

Gene ID
Molecular Construction
N-term
EFNA5 (Q21-N203)
Accession # F7GZC7
His
C-term
Synonyms
Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7
AA Sequence

QDPGSKTVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Molecular Weight

Approximately 27 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76322
Quantity:
MCE Japan Authorized Agent: