Ephrin B3 Protein, Mouse (HEK293, His)

Ephrin B3 protein, a transmembrane ligand, binds adjacent Eph receptors, triggering bidirectional signaling. It induces axon collapse in vitro and may influence axon guidance and orientation. Ephrin B3 interacts with GRIP1 and GRIP2, suggesting regulatory roles in development and cellular functions. Ephrin B3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin B3 Protein, Mouse (HEK293, His) is 200 a.a., with molecular weight of ~23.5 kDa.

Ephrin B3 protein, a cell surface transmembrane ligand for Eph receptors crucial in neuronal, vascular, and epithelial development, engages in contact-dependent bidirectional signaling by binding promiscuously to Eph receptors on adjacent cells. This leads to forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. With potential significance in forebrain function, Ephrin B3 binds to and induces the collapse of commissural axons/growth cones in vitro, suggesting a role in axon guidance. Additionally, it may contribute to constraining the orientation of longitudinally projecting axons. The protein interacts with GRIP1 and GRIP2, further emphasizing its involvement in intricate signaling processes and potential regulatory roles during development and cellular functions.

Immobilized mouse EFNB3-His at 10μg/mL (100μL/well) can bind biotinylated mouse EPHB3, the ED50 for this effect is 0.5188 μg/mL.

Mouse

HEK293

C-His

O35393 (L28-A227)

13643  [NCBI]

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA

Approximately 30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.