1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-B3
  6. Ephrin B3 Protein, Rat (HEK293, His)

Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue(s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin B3 Protein, Rat (HEK293, His) is 197 a.a., with molecular weight of 27-32 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue(s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin B3 Protein, Rat (HEK293, His) is 197 a.a., with molecular weight of 27-32 kDa.

Background

Ephrin B3 protein is a member of the ephrin family and is characterized by the absence of conserved residue(s) crucial for the propagation of feature annotation. This distinctive feature suggests a unique molecular profile within the ephrin family, potentially influencing its functional properties and interactions. The specific role and implications of this divergence in conserved residues warrant further investigation to comprehend the functional nuances and cellular significance of Ephrin B3 in biological processes.

Biological Activity

Immobilized Rat Ephrin B3 at 10μg/mL (100μL/well) can bind biotinylated Mouse EphB3, the ED50 for this effect is 36.91 ng/mL.

  • Immobilized Rat Ephrin B3 at 10μg/mL (100μL/well) can bind biotinylated Mouse EphB3, the ED50 for this effect is 36.91 ng/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

G3V7D4 (L28-S224)

Gene ID
Molecular Construction
N-term
Ephrin B3 (L28-S224)
Accession # G3V7D4
His
C-term
Synonyms
Ephrin-B3; EPH-related receptor tyrosine kinase ligand 8; LERK-8; EFNB3; EPLG8
AA Sequence

MGGPHFGPGGVQVGALLLLGFAGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSQEPGKDSIPGDPNSNATSRGAEGPLPPPS

Molecular Weight

Approximately 27-32 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin B3 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin B3 Protein, Rat (HEK293, His)
Cat. No.:
HY-P73022
Quantity:
MCE Japan Authorized Agent: