1. Recombinant Proteins
  2. Others
  3. EPS15 Protein, Human (His)

EPS15 is a multifunctional protein that regulates cell growth, controls mitotic signaling, and contributes to receptor tyrosine kinase (RTK) internalization, particularly affecting EGFR. As a clathrin adapter, EPS15 is critical for the assembly and maturation of clathrin-coated pits (CCP), affecting the endocytosis of molecules such as ITGB1 and transferrin receptor (TFR). EPS15 Protein, Human (His) is the recombinant human-derived EPS15 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EPS15 is a multifunctional protein that regulates cell growth, controls mitotic signaling, and contributes to receptor tyrosine kinase (RTK) internalization, particularly affecting EGFR. As a clathrin adapter, EPS15 is critical for the assembly and maturation of clathrin-coated pits (CCP), affecting the endocytosis of molecules such as ITGB1 and transferrin receptor (TFR). EPS15 Protein, Human (His) is the recombinant human-derived EPS15 protein, expressed by E. coli , with N-6*His labeled tag.

Background

EPS15, a multifaceted protein, intricately regulates cell growth and plays a pivotal role in the control of mitogenic signals and cell proliferation. It is particularly involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) family, with a notable impact on EGFR internalization. Functioning as a clathrin adapter, EPS15 is indispensable for the assembly of clathrin-coated pits (CCPs) and contributes to CCPs' maturation, including processes like invagination or budding. Its involvement extends to endocytosis of key molecules such as integrin beta-1 (ITGB1) and transferrin receptor (TFR), with the internalization of ITGB1 relying on its association with DAB2. EPS15 engages in a complex network of protein interactions, including SGIP1, HGS, STAM, STAM2, AP2A2, STON2, CRK, SH3BP4/TTP, ERBB2, FCHO1, FCHO2, DAB2, CORO7, UBQLN1, UBQLN2, REPS2, and EPN1, underscoring its versatility and significance in various cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P42566-1 (C657-D798)

Gene ID
Molecular Construction
N-term
6*His
EPS15 (C657-D798)
Accession # P42566-1
C-term
Synonyms
Eps15 epidermal; growth factor receptor pathway substrate 15; 2410112D09Rik; epidermal growth factor receptor substrate 15; epidermal growth factor pathway substrate 15; protein AF-1p
AA Sequence

CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD

Molecular Weight

20.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EPS15 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EPS15 Protein, Human (His)
Cat. No.:
HY-P700485
Quantity:
MCE Japan Authorized Agent: