1. Recombinant Proteins
  2. Others
  3. FAM167A Protein, Human (HEK293, Myc, His)

FAM167A protein shows significant expression in multiple tissues, including skin, spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles in various physiological processes across organs and cell types. FAM167A Protein, Human (HEK293, Myc, His) is the recombinant human-derived FAM167A protein, expressed by HEK293 , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FAM167A protein shows significant expression in multiple tissues, including skin, spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles in various physiological processes across organs and cell types. FAM167A Protein, Human (HEK293, Myc, His) is the recombinant human-derived FAM167A protein, expressed by HEK293 , with N-His, C-Myc labeled tag.

Background

FAM167A protein is notably expressed in various tissues, including the skin (including primary keratinocytes), spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles for FAM167A in a range of physiological processes across different organs and cell types. Its presence in skin, spleen, and kidney implicates it in skin biology, immune responses, and renal functions, while its expression in testis hints at involvement in reproductive processes. The wide distribution of FAM167A across multiple tissues emphasizes its potential versatility and underscores the importance of further investigation to elucidate its specific functions and contributions in different cellular contexts.

Species

Human

Source

HEK293

Tag

N-His;C-Myc

Accession

Q96KS9 (M1-C214)

Gene ID
Molecular Construction
N-term
10*His
FAM167A (M1-C214)
Accession # Q96KS9
Myc
C-term
Synonyms
FAM167A; C8orf13Protein FAM167A
AA Sequence

MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC

Molecular Weight

Approximately 28.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FAM167A Protein, Human (HEK293, Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FAM167A Protein, Human (HEK293, Myc, His)
Cat. No.:
HY-P71678
Quantity:
MCE Japan Authorized Agent: