FAU Protein, Human (GST)

FAU proteins are involved in potential proapoptotic activities, suggesting involvement in programmed cell death pathways. It functions in the 40S ribosomal subunit and is essential for assembly and function. FAU Protein, Human (GST) is the recombinant human-derived FAU protein, expressed by E. coli , with N-GST labeled tag.

The FAU protein is implicated in potential pro-apoptotic activities, suggesting its involvement in programmed cell death pathways. Additionally, it functions as a component of the 40S subunit of the ribosome, playing a crucial role in the assembly and function of these subunits. The dual nature of FAU, both in apoptotic regulation and its contribution to ribosomal subunit assembly, underscores its multifaceted role within cellular processes, spanning from programmed cell death mechanisms to fundamental aspects of protein synthesis. The precise mechanisms underlying FAU's pro-apoptotic activity and its impact on ribosomal function remain areas of interest in understanding its broader cellular functions.

Human

E. coli

N-GST

P62861/NM_001997 (M1-S133)

2197  [NCBI]

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Approximately 41.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.