Fc epsilon RIA/FCER1A Protein, Mouse (HEK293, Fc)

Fc epsilon RIA/FCER1A protein is a high-affinity receptor for immunoglobulin epsilon/IgE and is critical for mediating IgE effector function. It activates and differentiates myeloid cells after binding IgE and cross-linking with antigens/allergens, causing mast cells, basophils, and eosinophils to secrete mediators and cytokines. Fc epsilon RIA/FCER1A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Fc epsilon RIA/FCER1A protein, expressed by HEK293 , with C-hFc labeled tag.

Fc epsilon RIA/FCER1A Protein is a high-affinity receptor for immunoglobulin epsilon/IgE. It plays a crucial role in mediating IgE effector functions in myeloid cells. Upon binding IgE and cross-linking with antigen/allergen, it initiates signaling pathways that activate and differentiate myeloid cells. This activation leads to the secretion of vasoactive amines, lipid mediators, and cytokines by mast cells, basophils, and eosinophils, which contribute to inflammatory responses, tissue remodeling, and cytotoxicity against microbes. The protein is responsible for triggering the immediate hypersensitivity response to allergens, acting as a host defense mechanism against helminth parasites, pathogenic bacteria, and venom toxicity. However, when dysregulated, it can cause harmful, life-threatening allergic and anaphylactic reactions. Structurally, Fc epsilon RIA/FCER1A Protein consists of a tetramer comprising an alpha chain, a beta chain, and two disulfide-linked gamma chains. It interacts with IGHE through its CH3 region.

Mouse

HEK293

C-hFc

P20489 (A24-Q204)

14125  [NCBI]

ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ

Approximately 64.07 kDa

• 
  Greater than 85% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.