Fc gamma RIIA/CD32a Protein, Rat (HEK293, His)

Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Rat (HEK293, His) is the recombinant rat-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-His labeled tag.

The Fc gamma RIIA/CD32a protein assumes a pivotal role by specifically binding to the Fc region of immunoglobulins gamma, functioning as a low-affinity receptor. Through its interaction with IgG, Fc gamma RIIA/CD32a initiates cellular responses against pathogens and soluble antigens, illustrating its crucial involvement in immune modulation. Notably, the protein promotes the phagocytosis of opsonized antigens, further contributing to immune defense mechanisms. Additionally, Fc gamma RIIA/CD32a engages in interactions with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK, indicating its participation in intricate signaling pathways and the regulation of its cellular functions. These multifaceted interactions underscore the significance of Fc gamma RIIA/CD32a in orchestrating diverse immune responses.

Immobilized CD32a at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED₅₀ for this effect is 9.252 μg/mL, corresponding to a specific activity is 1.08×10^2 Unit/mg.

• 
  Immobilized CD32a at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED₅₀ for this effect is 9.252 μg/mL, corresponding to a specific activity is 1.08×10² Unit/mg.

Rat

HEK293

C-His

M0R4F7 (Q34-L216)

498276  [NCBI]

QTGDLLKAVVKRDPPWIQVLKDDTVTLTCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPIHLEVISDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTITVQGSATASTSSL

28-40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.