Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His)

The Fc γ RIIA/CD32a protein plays a key role by specifically binding to the Fc region of immunoglobulin γ, acting as a low-affinity receptor. Fc γ RIIA/CD32a initiates cellular responses against pathogens and soluble antigens and plays an important role in immune regulation. Fc γ RIIA/CD32a interacts with PI3K and Syk. Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-His labeled tag. The total length of Fc gamma RIIA/CD32a Protein, Rhesus Macaque (HEK293, His) is 184 a.a., with molecular weight of ~25-35 kDa.

The Fc γ RIIA/CD32a protein plays a key role by specifically binding to the Fc region of immunoglobulin γ, acting as a low-affinity receptor. By interacting with IgG, Fc γ RIIA/CD32a initiates cellular responses against pathogens and soluble antigens, playing an important role in immune regulation. The Fc γ RIIA/CD32a protein promotes the phagocytosis of  sporophoric antigens, further promoting the immune defense mechanism. In addition, Fc γ RIIA/CD32a interacts with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK to participate in complex signaling pathways and regulate their cellular functions. Fc γ RIIA/CD32a interacts with PI3K and Syk^[1][2][3].

Measured by its binding ability in a functional ELISA. Immobilized Rhesus Macaque CD32a protein at 5 μg/mL (100 μL/well) can bind Human IgG1. The ED₅₀ for this effect is 0.8076 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rhesus Macaque CD32a protein at 5μg/mL(100μL/well) can bind Human IgG1. The ED₅₀ for this effect is 0.8076 μg/mL.

Rhesus Macaque

HEK293

C-His

H9BMP0 (Q34-I217)

719996  [NCBI]

QTAPPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYMFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTTHLEFREGETIMLRCHSWKDKPLIKVAFFQNGKSKNFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSVGSSSPMGI

Approximately 25-35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE. It migrates as an approximately 25-35 kDa band in SDS-PAGE under reducing conditions.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.