1. Recombinant Proteins
  2. CD Antigens Fc Receptors Biotinylated Proteins
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. FcγRIIIB/CD16b Fc gamma RIII/CD16
  5. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi)

Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi)

Cat. No.: HY-P78122
Handling Instructions Technical Support

Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi) is 184 a.a., with molecular weight of 47-53 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi) is 184 a.a., with molecular weight of 47-53 kDa.

Background

The Fc gamma RIIIB/CD16b Protein acts as a receptor for the Fc region of immunoglobulins gamma, exhibiting low affinity and binding to both complexed or aggregated IgG as well as monomeric IgG. In contrast to Fc gamma RIIIA, Fc gamma RIIIB lacks the ability to mediate antibody-dependent cytotoxicity and phagocytosis. Instead, it may function as a trap for immune complexes circulating in the periphery, without activating neutrophils. The protein exists as a monomer and interacts with INPP5D/SHIP1, suggesting its involvement in intracellular signaling pathways associated with immune responses.

Biological Activity

1. Biotinylated Human Fc gamma RIIIB (NA2) His captured on CM5 Chip via Anti-His Antibody can bind Rituximab hFc with an affinity constant of 4.3 μM as determined in SPR assay.
2. Rituximab captured on CM5 Chip via Protein A can bind Biotinvlated Human Fc gamma RIIIB. His-Avi Tag with an affinity constant of 6.48 μM as determined in SPR assay (Biacore T200).

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

O75015 (G17-S200)

Gene ID
Molecular Construction
N-term
CD16b (G17-S200)
Accession # O75015
His-Avi
C-term
Synonyms
CD16; Fc gamma RIIIB; FCG3; Fc-gamma receptor IIIb (CD 16); Fc-gamma RIIIb; Fc-gamma RIII-beta; FCGR3B; FcgRIIIB; FCRIIIB; IGFR3; IgG Fc receptor III-1; CD16b (NA2); CD16B; FCG3B; FCG3; FCGR3; FCR-10; Fc-gamma RIII-β
AA Sequence

GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS

Molecular Weight

47-53 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi)
Cat. No.:
HY-P78122
Quantity:
MCE Japan Authorized Agent: