Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi)

Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi) is 184 a.a., with molecular weight of 47-53 kDa.

The Fc gamma RIIIB/CD16b Protein acts as a receptor for the Fc region of immunoglobulins gamma, exhibiting low affinity and binding to both complexed or aggregated IgG as well as monomeric IgG. In contrast to Fc gamma RIIIA, Fc gamma RIIIB lacks the ability to mediate antibody-dependent cytotoxicity and phagocytosis. Instead, it may function as a trap for immune complexes circulating in the periphery, without activating neutrophils. The protein exists as a monomer and interacts with INPP5D/SHIP1, suggesting its involvement in intracellular signaling pathways associated with immune responses.

1. Biotinylated Human Fc gamma RIIIB (NA2) His captured on CM5 Chip via Anti-His Antibody can bind Rituximab hFc with an affinity constant of 4.3 μM as determined in SPR assay.
2. Rituximab captured on CM5 Chip via Protein A can bind Biotinvlated Human Fc gamma RIIIB. His-Avi Tag with an affinity constant of 6.48 μM as determined in SPR assay (Biacore T200).

Human

HEK293

C-Avi;C-His

O75015 (G17-S200)

2215  [NCBI]

GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS

47-53 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.