1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-12
  6. FGF-12 Protein, Human (177 a.a)

FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.

Background

Fibroblast growth factors (FGFs) play important roles in embryogenesis, angiogenesis, and wound repair, and the FGF family is currently composed of 22 members in humans. FGF12, initially designated as FGF homologous factor 1 (FHF1), is identified by its sequence homology to known FGFs, and it has a high degree of homology with FGF11 (FHF2), FGF12 (FHF3), and FGF14 (FHF4), with a 58–71% amino acid sequence identity with these FGF11 subfamily members. FGF12 has structural similarity with FGF1 and FGF2, in that it lacks a classical signal sequence and contains a nuclear localization signal (NLS), resulting in the accumulation of FGF12 in the nucleus without any release from cells. FGF12 has two forms, a long form (FGF12A) and a short form (FGF12B). FGF12B lacks the NLS because the N-terminal 66 amino acid residues of FGF12A are substituted by 4 amino acids by means of alternative splicing. FGF12 can play a role in tissues by translocating into cells through the plasma membrane, and the availability of this novel CPP provides a new tool for the intracellular delivery of bioactive molecules[1].

Biological Activity

1. The ED50 is <20 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >5 × 104 units/mg.
2. Immobilized Human FGF-12 at 2.0 μg/ml (100 μl/well) can bind Human FGFR3-Fc. The ED50 of Human FGF-12 is 0.5-4.0 μg/ml.
3. Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 this effect is 9.139 ng/mL, corresponding to a specific activity is 1.094×10^5 U/mg.

  • easured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 9.139 ng/mL, corresponding to a specific activity is 1.094×105 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P61328-1 (E67-T243)

Gene ID
Molecular Construction
N-term
FGF-12 (E67-T243)
Accession # P61328-1
C-term
Synonyms
rHuFGF-12; FHF1; FGF12B
AA Sequence

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Weight

Approximately 20.4 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FGF-12 Protein, Human (177 a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-12 Protein, Human (177 a.a)
Cat. No.:
HY-P7343
Quantity:
MCE Japan Authorized Agent: