FGF-9 Protein, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of FGF-9 Protein, Human (HEK293, Fc, solution) is 205 a.a., with molecular weight of ~54 & 37 kDa, respectively.

The FGF-9 Protein, belonging to the fibroblast growth factor (FGF) family, exhibits broad mitogenic and cell survival activities, participating in various biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, and tumor growth and invasion. Originally identified as a secreted factor with growth-stimulating effects on cultured glial cells, this protein is predominantly produced by neurons in the nervous system, suggesting its importance in glial cell development. The expression of the mouse homolog of FGF-9 is contingent on Sonic hedgehog (Shh) signaling, and its absence in mice led to a male-to-female sex reversal phenotype, indicating a role in testicular embryogenesis. Noteworthy is the biased expression of FGF-9, with elevated levels detected in the kidney (RPKM 6.4), adrenal (RPKM 2.1), and 10 other tissues, underscoring its potential significance in various physiological contexts across multiple organs.

Measured in a cell proliferation assay using Balb/c 3T3 mouse embryonic fibroblasts and the ED₅₀ is typically 10-60 ng/mL.

Human

HEK293

N-hFc

NP_002001.1 (L4-S208)

2254  [NCBI]

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Approximately 54&37 kDa

Greater than 85%, as determined by reducing SDS-PAGE

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.