2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. FGF Family
  5. Fibroblast Growth Factor
  6. FGF-2/bFGF
  7. FGF2 Protein, Chicken (N-His, C-Myc)

FGF2 Protein, Chicken (N-His, C-Myc)

Cat. No.: HY-P700487
Handling Instructions

FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (N-His, C-Myc) is the recombinant FGF2 protein, expressed by E. coli, with C-Myc, N-10*His labeled tag. The total length of FGF2 Protein, Chicken (N-His, C-Myc) is 146 a.a., with molecular weight of 23.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (N-His, C-Myc) is the recombinant FGF2 protein, expressed by E. coli, with C-Myc, N-10*His labeled tag. The total length of FGF2 Protein, Chicken (N-His, C-Myc) is 146 a.a., with molecular weight of 23.8 kDa.
Background

The FGF2 protein serves as a ligand for FGFR1, FGFR2, FGFR3, and FGFR4, as well as an integrin ligand necessary for FGF2 signaling. It plays a crucial role in regulating cell survival, division, differentiation, and migration. Additionally, FGF2 functions as a potent mitogen in vitro and has the ability to induce angiogenesis.
Species

Others
Source

E. coli
Tag

C-Myc;N-10*His
Accession

P48800 (P13-S158)
Gene ID

396413  [NCBI]
Molecular Construction
N-term
10*His
FGF2 (P13-S158)
Accession # P48800
Myc
C-term
Synonyms
Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2
AA Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Molecular Weight

23.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

FGF2 Protein, Chicken (N-His, C-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF2 Protein, Chicken (N-His, C-Myc)
Cat. No.:
HY-P700487
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.