FGL1 Protein, Cynomolgus (HEK293, His)

Fibrinogen like 1 (FGL1) is a proliferation- and metabolism-related protein secreted by the liver. FGL1 is also upregulated in tumor tissues. FGL1 is a checkpoint ligand of lymphocyte activation gene 3 (LAG3). When binding to LAG3, FGL1 can inhibit T cell activation and proliferation. FGL1 can be used for research of immune checkpoint therapy. FGL1 plays a role in proliferation, metabolism, apoptosis, epithelial-to-mesenchymal transition, and immune infiltration^[1][2][3][4]. FGL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FGL1 Protein, Cynomolgus (HEK293, His) is 290 a.a., with molecular weight of ~35 kDa.

Fibrinogen like 1 (FGL1), also known as HFREP-1 or hepassocin (HPS), is a proliferation- and metabolism-related protein secreted by the liver. FGL1 is a newly emerging checkpoint ligand of lymphocyte activation gene 3 (LAG3). When binding to LAG3, it can inhibit T cell activation and proliferation. Therefore, FGL1 can potentiate anti-tumor T cell responses and can be used for research of immune checkpoint therapy. Apart from the high expression in the liver, FGL1 is also upregulated in tumor tissues (such as lung, prostate, melanoma, colorectal, breast and brain tumors) and mediates EMT process. FGL1 is an approxiamte 68-KD protein comprised of a disulfide bond-linked homodimer^[1][2][3].
Besides, as a liver protective factor, FGL1 accelerates the growth of liver cells by promoting mitochondrial mitosis in the event of liver injury. FGL1 plays a role in proliferation, metabolism, apoptosis, epithelial-to-mesenchymal transition, and immune infiltration^[3][4].

Cynomolgus

HEK293

C-6*His

A0A2K5X990 (L23-I312)

102118020

LEDCAQEQVRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGEENSVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFAVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGSFHPEVQWWATHQRMKFSTWDRDHDNYDGNCAEEDQSGWWFNRCHSANLNGLYYTGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Approximately 35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.