1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. FGL-1
  5. FGL1 Protein, Cynomolgus (HEK293, His)

Fibrinogen like 1 (FGL1) is a proliferation- and metabolism-related protein secreted by the liver. FGL1 is also upregulated in tumor tissues. FGL1 is a checkpoint ligand of lymphocyte activation gene 3 (LAG3). When binding to LAG3, FGL1 can inhibit T cell activation and proliferation. FGL1 can be used for research of immune checkpoint therapy. FGL1 plays a role in proliferation, metabolism, apoptosis, epithelial-to-mesenchymal transition, and immune infiltration. FGL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FGL1 Protein, Cynomolgus (HEK293, His) is 290 a.a., with molecular weight of ~35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fibrinogen like 1 (FGL1) is a proliferation- and metabolism-related protein secreted by the liver. FGL1 is also upregulated in tumor tissues. FGL1 is a checkpoint ligand of lymphocyte activation gene 3 (LAG3). When binding to LAG3, FGL1 can inhibit T cell activation and proliferation. FGL1 can be used for research of immune checkpoint therapy. FGL1 plays a role in proliferation, metabolism, apoptosis, epithelial-to-mesenchymal transition, and immune infiltration[1][2][3][4]. FGL1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FGL1 Protein, Cynomolgus (HEK293, His) is 290 a.a., with molecular weight of ~35 kDa.

Background

Fibrinogen like 1 (FGL1), also known as HFREP-1 or hepassocin (HPS), is a proliferation- and metabolism-related protein secreted by the liver. FGL1 is a newly emerging checkpoint ligand of lymphocyte activation gene 3 (LAG3). When binding to LAG3, it can inhibit T cell activation and proliferation. Therefore, FGL1 can potentiate anti-tumor T cell responses and can be used for research of immune checkpoint therapy. Apart from the high expression in the liver, FGL1 is also upregulated in tumor tissues (such as lung, prostate, melanoma, colorectal, breast and brain tumors) and mediates EMT process. FGL1 is an approxiamte 68-KD protein comprised of a disulfide bond-linked homodimer[1][2][3].
Besides, as a liver protective factor, FGL1 accelerates the growth of liver cells by promoting mitochondrial mitosis in the event of liver injury. FGL1 plays a role in proliferation, metabolism, apoptosis, epithelial-to-mesenchymal transition, and immune infiltration[3][4].

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

A0A2K5X990 (L23-I312)

Gene ID

102118020

Molecular Construction
N-term
FGL1 (L23-I312)
Accession # A0A2K5X990
6*His
C-term
Synonyms
Fibrinogen like 1; FGL1
AA Sequence

LEDCAQEQVRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGEENSVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFAVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGSFHPEVQWWATHQRMKFSTWDRDHDNYDGNCAEEDQSGWWFNRCHSANLNGLYYTGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Weight

Approximately 35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGL1 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGL1 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P72642
Quantity:
MCE Japan Authorized Agent: