1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Fluorescent-labeled Recombinant Proteins
  3. CD314/NKG2D T Cell CD Proteins NK Cell CD Proteins
  4. CD314/NKG2D
  5. FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc)

FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc)

Cat. No.: HY-P701284
SDS COA Handling Instructions Technical Support

The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells. It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8(+) T cell-mediated adaptive responses. FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc) is the recombinant human-derived FITC-Labeled NKG2D/CD314 protein, expressed by HEK293 , with N-hFc, N-Flag labeled tag. The total length of FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc) is 139 a.a., with molecular weight of 50-70 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells. It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8(+) T cell-mediated adaptive responses. FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc) is the recombinant human-derived FITC-Labeled NKG2D/CD314 protein, expressed by HEK293 , with N-hFc, N-Flag labeled tag. The total length of FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc) is 139 a.a., with molecular weight of 50-70 kDa.

Background

NKG2D/CD314 protein operates as an activating and costimulatory receptor essential for immunosurveillance, binding to diverse cellular stress-inducible ligands presented on autologous tumor cells and virus-infected cells. It plays a dual role in innate immune responses, stimulating both activating killer (NK) cells and acting as a costimulatory receptor for T-cell receptors (TCR) in CD8(+) T-cell-mediated adaptive immune responses, enhancing T-cell activation. The receptor facilitates perforin-mediated elimination of ligand-expressing tumor cells, and its signaling cascades involve calcium influx, ultimately leading to TNF-alpha expression. Additionally, NKG2D/CD314 participates in NK cell-mediated bone marrow graft rejection and may regulate the differentiation and survival of NK cells. Its ligand-binding capacity extends to various subfamilies of MHC class I-related glycoproteins, including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3), and ULBP4. The protein forms homodimers through disulfide linkage and heterohexamers with HCST/DAP10 subunits, a crucial interaction for NK cell surface expression and cytotoxicity induction. Furthermore, it can establish disulfide-bonded heterodimers with CD94 and interacts with CEACAM1, recruiting PTPN6 for VAV1 dephosphorylation, while not interacting with TYROBP.

Species

Human

Source

HEK293

Tag

N-hFc;N-Flag

Accession

P26718 (F78-V216)

Gene ID

22914/100528032

Synonyms
NKG2D; CD314; KLRK1; NK cell receptor D
AA Sequence

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Molecular Weight

50-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year, protect from light. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P701284
Quantity:
MCE Japan Authorized Agent: