1. Recombinant Proteins
  2. CAR-T Related Proteins Receptor Proteins
  3. Folate Receptor alpha (FR-alpha)
  4. FOLR1 Protein, Rat (HEK293, Fc)

The FOLR1 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind folate (vitamin B9) and transport it into cells. FOLR1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived FOLR1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of FOLR1 Protein, Rat (HEK293, Fc) is 212 a.a., with molecular weight of ~50.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

FOLR1 Protein, Rat (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FOLR1 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind folate (vitamin B9) and transport it into cells. FOLR1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived FOLR1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of FOLR1 Protein, Rat (HEK293, Fc) is 212 a.a., with molecular weight of ~50.9 kDa.

Background

FOLR1 Protein is a member of the folate receptor family. Folate receptors are cell surface proteins that bind and transport folate (vitamin B9) into cells. FOLR1 is widely expressed in various tissues, including the placenta, kidney, lung, and intestine. It plays a crucial role in folate metabolism by mediating the cellular uptake of folate. FOLR1 is particularly important during pregnancy, as it facilitates the transport of folate across the placenta to support fetal development. In addition to its role in folate transport, FOLR1 has been implicated in other cellular processes, including cell adhesion, migration, and signaling. It is also being investigated as a potential target for cancer therapy, as FOLR1 expression is frequently upregulated in several types of cancer cells, making it a promising candidate for targeted drug delivery.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

G3V8M6/NP_598211.1 (A20-M231)

Gene ID
Molecular Construction
N-term
FOLR1 (A20-M231)
Accession # G3V8M6/NP_598211.1
hFc
C-term
Synonyms
Folate receptor alpha; FR-alpha; FBP; FOLR1; FOLR
AA Sequence

AQSRATRARTELLNVCMDAKHHKEKPGPEDKLHDQCSPWKTNACCSTNTSQEDTKDISYLYRFNWNHCGTMTPECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCVLWWEDCKSSFTCKSNWLKGWNWTSGHNECPVGASCHPFTFYFPTPAVLCEKIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEVM

Molecular Weight

Approximately 50.9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FOLR1 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FOLR1 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75775
Quantity:
MCE Japan Authorized Agent: