1. Recombinant Proteins
  2. Receptor Proteins
  3. FOLR2 Protein, Human (HEK293, His)

FOLR2 Protein, Human (HEK293, His)

Cat. No.: HY-P76348
SDS COA Handling Instructions

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag. The total length of FOLR2 Protein, Human (HEK293, His) is 212 a.a., with molecular weight of 28-35 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $42 In-stock
10 μg $68 In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag. The total length of FOLR2 Protein, Human (HEK293, His) is 212 a.a., with molecular weight of 28-35 KDa.

Background

The FOLR2 protein binds to folate and reduced folic acid derivatives, facilitating the transport of 5-methyltetrahydrofolate and folate analogs into the intracellular space. It exhibits a high affinity for folate and folic acid analogs under neutral pH conditions. However, upon receptor endocytosis, exposure to a slightly acidic pH triggers a conformational change in FOLR2, resulting in a significant reduction in its affinity for folates and subsequent release from the receptor.

Biological Activity

Measured by its binding ability in a functional ELISA. When Folic acid -BSA conjugate is coated at 5 μg/mL (100 μL/well), the concentration of rhFOLR2 that produces 50% of the optimal binding response is found to be approximately 0.983 nM.

  • Measured by its binding ability in a functional ELISA. When Folic acid -BSA conjugate is coated at 5 μg/mL (100 μL/well), the concentration of rhFOLR2 that produces 50% of the optimal binding response is found to be approximately 0.983 nM.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P14207 (T17-H228)

Gene ID
Molecular Construction
N-term
FOLR2 (T17-H228)
Accession # P14207
His
C-term
Synonyms
Folate receptor beta; FR-beta; Placental folate-binding protein; FBP
AA Sequence

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FOLR2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FOLR2 Protein, Human (HEK293, His)
Cat. No.:
HY-P76348
Quantity:
MCE Japan Authorized Agent: