FOLR2 Protein, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag. The total length of FOLR2 Protein, Human (HEK293, His) is 212 a.a., with molecular weight of 28-35 KDa.

The FOLR2 protein binds to folate and reduced folic acid derivatives, facilitating the transport of 5-methyltetrahydrofolate and folate analogs into the intracellular space. It exhibits a high affinity for folate and folic acid analogs under neutral pH conditions. However, upon receptor endocytosis, exposure to a slightly acidic pH triggers a conformational change in FOLR2, resulting in a significant reduction in its affinity for folates and subsequent release from the receptor.

Measured by its binding ability in a functional ELISA. When Folic acid -BSA conjugate is coated at 5 μg/mL (100 μL/well), the concentration of rhFOLR2 that produces 50% of the optimal binding response is found to be approximately 0.983 nM.

• 
  Measured by its binding ability in a functional ELISA. When Folic acid -BSA conjugate is coated at 5 μg/mL (100 μL/well), the concentration of rhFOLR2 that produces 50% of the optimal binding response is found to be approximately 0.983 nM.

Human

HEK293

C-6*His

P14207 (T17-H228)

2350  [NCBI]

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Approximately 28-35 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.