Frizzled-10/CD350 Protein, Mouse (HEK293, His)

Frizzled-10/CD350 protein is a receptor for Wnt proteins that functions in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target gene activation. Secondary signaling pathways involve PKC and calcium flux. Frizzled-10/CD350 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag. The total length of Frizzled-10/CD350 Protein, Mouse (HEK293, His) is 141 a.a., with molecular weight of 20-24 kDa.

Frizzled-10/CD350 Protein operates as a receptor for Wnt proteins, functioning primarily in the canonical Wnt/beta-catenin signaling pathway. This pathway orchestrates the activation of disheveled proteins, inhibits GSK-3 kinase, facilitates nuclear accumulation of beta-catenin, and triggers the activation of Wnt target genes. Alongside the canonical pathway, a secondary signaling route involving PKC and calcium fluxes has been identified for some family members. The interplay between these pathways and their potential integration remains to be fully elucidated, given PKC's apparent role in Wnt-mediated inactivation of GSK-3 kinase. Frizzled-10 may play a crucial role in transducing and transmitting polarity information during tissue morphogenesis or within differentiated tissues. Interactions with MYOC and WNT7B underscore its involvement in intricate cellular processes and signal transduction cascades.

Measured by its ability to bind biotinylated recombinant mouse Wnt-3a in a functional ELISA. The ED₅₀ for this effect is 38.32 ng/mL.

Mouse

HEK293

C-6*His

Q8BKG4/NP_780493.1(I22-G162)

93897  [NCBI]

ISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRG

Approximately 20-24 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.