FSHR Protein, Human (His)

FSHR, a G protein-coupled receptor, specifically recognizes follitropin (FSH) and activates PI3K-AKT and ERK1/ERK2 pathways by promoting cAMP production. Operating as a homotrimer, FSHR binds the heterodimeric FSH hormone, forming a functional unit for signal transduction. Its regulatory mechanisms involve interaction with ARRB2, and independently of FSH stimulation, it engages with APPL2, demonstrating versatility in diverse cellular contexts. FSHR Protein, Human (His) is the recombinant human-derived FSHR protein, expressed by E. coli , with N-6*His labeled tag.

FSHR is a G protein-coupled receptor specifically designed for the recognition of follitropin, also known as follicle-stimulating hormone. This receptor activates downstream signaling pathways, including the PI3K-AKT and ERK1/ERK2 pathways, by facilitating cAMP production. As a homotrimer, FSHR binds to the heterodimeric FSH hormone, consisting of CGA and FSHB subunits, forming a functional unit for signal transduction. FSHR's interaction with ARRB2 contributes to its regulatory mechanisms, and it also engages with APPL2 independently of follicle-stimulating hormone stimulation, showcasing its versatility in diverse cellular contexts.

Immobilized Human FSH at 2 μg/mL (100 μL/well) can bind Human FSHR. The ED₅₀ for this effect is 0.265 μg/mL.

Human

E. coli

N-6*His

P23945-1 (C18-R366)

2492  [NCBI]

CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

47-51 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4 or10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.