Fusion glycoprotein F0/F Protein, HRSV (sf9, His)

The fusion glycoprotein F0/F protein is initially an inactive precursor that is cleaved by furin-like proteases to produce the mature F1 and F2 fusion glycoproteins.As a class I viral fusion protein, it undergoes prefusion, prehairpin, and postfusion states.Fusion glycoprotein F0/F Protein, HRSV (sf9, His) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by Sf9 insect cells , with C-His labeled tag.

The Fusion glycoprotein F0/F Protein acts as an inactive precursor, undergoing cleavage at two sites by a furin-like protease to generate the mature F1 and F2 fusion glycoproteins. As a class I viral fusion protein, it exhibits at least three conformational states: the pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and plasma cell membrane fusion, the coiled coil regions adopt a trimer-of-hairpins structure, placing the fusion peptide in proximity to the C-terminal region of the ectodomain. This structural arrangement drives the apposition and subsequent fusion of viral and cellular membranes, facilitating the delivery of the nucleocapsid into the cytoplasm. Importantly, this fusion is pH independent and occurs at the plasma or endosomal membrane. The trimer of F1-F2 (F protein) plays a dual role by aiding attachment to host cells through binding to host heparan sulfate and facilitating entry into the host cell via interaction with host IGFR1. Furthermore, F protein expressed at the plasma membrane during infection can mediate cell-cell fusion, leading to syncytia formation, a cytopathic effect potentially contributing to tissue necrosis. Additionally, F protein may trigger p53-dependent apoptosis later in infection.

Virus

Sf9 insect cells

C-His

P03420 (Q26-T529)

/

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

45-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0, 10% glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.