1. Recombinant Proteins
  2. Viral Proteins
  3. RSV Proteins
  4. RSV Fusion Proteins
  5. Fusion glycoprotein F0/F Protein, HRSV (sf9, His)

Fusion glycoprotein F0/F Protein, HRSV (sf9, His)

Cat. No.: HY-P75182
SDS COA Handling Instructions

The fusion glycoprotein F0/F protein is initially an inactive precursor that is cleaved by furin-like proteases to produce the mature F1 and F2 fusion glycoproteins.As a class I viral fusion protein, it undergoes prefusion, prehairpin, and postfusion states.Fusion glycoprotein F0/F Protein, HRSV (sf9, His) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The fusion glycoprotein F0/F protein is initially an inactive precursor that is cleaved by furin-like proteases to produce the mature F1 and F2 fusion glycoproteins.As a class I viral fusion protein, it undergoes prefusion, prehairpin, and postfusion states.Fusion glycoprotein F0/F Protein, HRSV (sf9, His) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The Fusion glycoprotein F0/F Protein acts as an inactive precursor, undergoing cleavage at two sites by a furin-like protease to generate the mature F1 and F2 fusion glycoproteins. As a class I viral fusion protein, it exhibits at least three conformational states: the pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and plasma cell membrane fusion, the coiled coil regions adopt a trimer-of-hairpins structure, placing the fusion peptide in proximity to the C-terminal region of the ectodomain. This structural arrangement drives the apposition and subsequent fusion of viral and cellular membranes, facilitating the delivery of the nucleocapsid into the cytoplasm. Importantly, this fusion is pH independent and occurs at the plasma or endosomal membrane. The trimer of F1-F2 (F protein) plays a dual role by aiding attachment to host cells through binding to host heparan sulfate and facilitating entry into the host cell via interaction with host IGFR1. Furthermore, F protein expressed at the plasma membrane during infection can mediate cell-cell fusion, leading to syncytia formation, a cytopathic effect potentially contributing to tissue necrosis. Additionally, F protein may trigger p53-dependent apoptosis later in infection.

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

P03420 (Q26-T529)

Gene ID

/

Molecular Construction
N-term
hMPV F (Q26-T529)
Accession # P03420
His
C-term
Synonyms
Human respiratory syncytial virus Fusion glycoprotein/RSV-F Protein; F Protein; HRSVgp08 Protein
AA Sequence

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

Molecular Weight

45-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0, 10% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Fusion glycoprotein F0/F Protein, HRSV (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fusion glycoprotein F0/F Protein, HRSV (sf9, His)
Cat. No.:
HY-P75182
Quantity:
MCE Japan Authorized Agent: