G-CSF Protein, Rhesus Macaque

CSF3 Protein, a member of the IL-6 superfamily, is a vital granulocyte/macrophage colony-stimulating factor influencing hematopoiesis. It regulates the production, differentiation, and function of granulocytes and monocytes-macrophages, playing a key role in the intricate balance of hematopoietic processes. CSF3's significance within the IL-6 superfamily extends to orchestrating immune system components for optimal functionality. G-CSF Protein, Rhesus Macaque is the recombinant rhesus macaque-derived G-CSF, expressed by E. coli , with tag Free labeled tag. The total length of G-CSF Protein, Rhesus Macaque is 177 a.a.,

The CSF3 Protein, belonging to the IL-6 superfamily, is a granulocyte/macrophage colony-stimulating factor that plays a crucial role in hematopoiesis. This cytokine exerts control over the production, differentiation, and function of two interconnected white cell populations in the blood, namely granulocytes and monocytes-macrophages. Specifically, CSF3 induces the generation of granulocytes, contributing to the intricate regulation of hematopoietic processes. As a key member of the IL-6 superfamily, CSF3 holds significance in orchestrating the balance and functionality of essential components within the immune system.

Rhesus Macaque

E. coli

Tag Free

F7H1Q6 (T31-S207)

698961

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS

Approximately 18.9 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU/μg, determined by LAL method.