GABRB2 Protein, Human (His)

GABRB2 protein is an important component of heteropentameric GABA receptors that form ligand-gated chloride channels. It plays a crucial role in establishing functional inhibitory GABAergic synapses, contributing to synaptic depression. GABRB2 Protein, Human (His) is the recombinant human-derived GABRB2 protein, expressed by E. coli , with N-His labeled tag.

The GABRB2 protein serves as a critical component of the heteropentameric receptor for gamma-aminobutyric acid (GABA), the principal inhibitory neurotransmitter in the brain. Functioning as a ligand-gated chloride channel, GABRB2 plays a vital role in the establishment of functional inhibitory GABAergic synapses, contributing to synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is essential for the rapid formation of active synaptic contacts, with the synaptogenic effect influenced by the specific combination of alpha and beta subunits in the receptor pentamer. Both the alpha1/beta2/gamma2 and alpha2/beta2/gamma2 receptor configurations exhibit synaptogenic activity. Beyond its role in GABA signaling, GABRB2 functions as a histamine receptor, mediating cellular responses to histamine. Moreover, the protein is allosterically activated by benzodiazepines and the anesthetic etomidate, while its activity is inhibited by the antagonist bicuculline.

Human

E. coli

N-His

P47870-1 (S26-Y244)

2561  [NCBI]

SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY

Approximately 29.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.