1. Recombinant Proteins
  2. Others
  3. GADD45A/DDDIT-1 Protein, Human (His)

GADD45A/DDDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDDIT-1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GADD45A/DDDIT-1 Protein, Human (His) is 165 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GADD45A/DDDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDDIT-1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GADD45A/DDDIT-1 Protein, Human (His) is 165 a.a., with molecular weight of ~18.0 kDa.

Background

In T-cells, the GADD45A/DDDIT-1 protein functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity, demonstrating its role in modulating cellular signaling pathways. Additionally, GADD45A/DDDIT-1 might influence the interaction between PCNA and certain CDK complexes, thereby stimulating DNA excision repair in vitro while inhibiting the entry of cells into the S phase of the cell cycle. The protein interacts with MAPK14, and its quaternary structure exhibits a dynamic range, predominantly existing as a monomer while forming dimers and other oligomers with increasing concentration. GADD45A/DDDIT-1 engages in specific protein-protein interactions, including weak interaction with PCNA and interaction with GADD45GIP1. Furthermore, it interacts with AURKA, suggesting a potential role in competing with dimerization processes related to cell cycle regulation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P24522 (M1-R165)

Gene ID
Molecular Construction
N-term
6*His
GADD45A (M1-R165)
Accession # P24522
C-term
Synonyms
rHuGrowth arrest and DNA damage-inducible protein GADD45 alpha/GADD45A, His; Growth Arrest and DNA Damage-Inducible Protein GADD45 Alpha; DNA Damage-Inducible Transcript 1 Protein; DDIT-1; GADD45A; DDIT1; GADD45
AA Sequence

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GADD45A/DDDIT-1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GADD45A/DDDIT-1 Protein, Human (His)
Cat. No.:
HY-P70326
Quantity:
MCE Japan Authorized Agent: