1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GhrA Protein, E.coli (His-SUMO)

GhrA is an enzyme involved in cellular metabolism and plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity contributes to the conversion of important metabolites and contributes to metabolic pathways related to glyoxylate detoxification and maintenance of cellular homeostasis. GhrA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived GhrA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GhrA is an enzyme involved in cellular metabolism and plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity contributes to the conversion of important metabolites and contributes to metabolic pathways related to glyoxylate detoxification and maintenance of cellular homeostasis. GhrA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived GhrA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

GhrA is an enzyme involved in cellular metabolism, and it plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity is instrumental in the conversion of important metabolites, contributing to metabolic pathways associated with glyoxylate detoxification and the maintenance of cellular homeostasis.

Species

E.coli

Source

E. coli

Tag

N-His;N-SUMO

Accession

B7LFE3 (M1-Y312)

Gene ID

/

Molecular Construction
N-term
6*His-SUMO
GhrA (M1-Y312)
Accession # B7LFE3
C-term
Synonyms
ghrA; EC55989_1146Glyoxylate/hydroxypyruvate reductase A; EC 1.1.1.79; EC 1.1.1.81; 2-ketoacid reductase
AA Sequence

MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY

Molecular Weight

Approximately 51.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GhrA Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GhrA Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71523
Quantity:
MCE Japan Authorized Agent: