GhrA Protein, E.coli (His-SUMO)

GhrA is an enzyme involved in cellular metabolism and plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity contributes to the conversion of important metabolites and contributes to metabolic pathways related to glyoxylate detoxification and maintenance of cellular homeostasis. GhrA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived GhrA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

GhrA is an enzyme involved in cellular metabolism, and it plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity is instrumental in the conversion of important metabolites, contributing to metabolic pathways associated with glyoxylate detoxification and the maintenance of cellular homeostasis.

E.coli

E. coli

N-His;N-SUMO

B7LFE3 (M1-Y312)

/

MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY

Approximately 51.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.