1. Recombinant Proteins
  2. Others
  3. Gliomedin Protein, Human (HEK293, N-hFc)

Gliomedin Protein, Human (HEK293, N-hFc)

Cat. No.: HY-P76363A
COA Handling Instructions

Gliomedin Protein, a collagen-rich homotrimer, crucially binds NRCAM and NFASC, playing a pivotal role in establishing and preserving nodes of Ranvier on myelinated axons. It mediates Schwann cell-axon interaction, promoting sodium channel clustering for efficient action potential propagation. Gliomedin, collaborating with NRCAM, ensures proper sodium channel clustering during development and maintains NFASC and sodium channel clusters at mature nodes of Ranvier. Its intricate involvement underscores Gliomedin Protein's significance in the structural integrity and organization of nodes of Ranvier. Gliomedin Protein, Human (HEK293, N-hFc) is the recombinant human-derived Gliomedin protein, expressed by HEK293, with N-hFc labeled tag. The total length of Gliomedin Protein, Human (HEK293, N-hFc) is 427 a.a., with molecular weight of 95-112 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $65 In-stock
10 μg $110 In-stock
50 μg $300 In-stock
100 μg $510 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Gliomedin Protein, a collagen-rich homotrimer, crucially binds NRCAM and NFASC, playing a pivotal role in establishing and preserving nodes of Ranvier on myelinated axons. It mediates Schwann cell-axon interaction, promoting sodium channel clustering for efficient action potential propagation. Gliomedin, collaborating with NRCAM, ensures proper sodium channel clustering during development and maintains NFASC and sodium channel clusters at mature nodes of Ranvier. Its intricate involvement underscores Gliomedin Protein's significance in the structural integrity and organization of nodes of Ranvier. Gliomedin Protein, Human (HEK293, N-hFc) is the recombinant human-derived Gliomedin protein, expressed by HEK293, with N-hFc labeled tag. The total length of Gliomedin Protein, Human (HEK293, N-hFc) is 427 a.a., with molecular weight of 95-112 kDa.

Background

Gliomedin, a homotrimeric protein characterized by collagen-like domains, acts as a crucial ligand for NRCAM and NFASC/neurofascin, playing a pivotal role in the establishment and preservation of nodes of Ranvier along myelinated axons. Its significance lies in mediating the interaction between Schwann cell microvilli and axons through binding to NRCAM and NFASC. Nodes of Ranvier are essential regions on myelinated axons housing clustered sodium channels vital for the saltatory propagation of action potentials. Gliomedin is specifically involved in the formation of nodes during development by facilitating the fusion of heminodes, and it is indispensable for the proper clustering of sodium channels at heminodes. Additionally, in collaboration with NRCAM, Gliomedin contributes to the maintenance of NFASC and sodium channel clusters at fully mature nodes of Ranvier. Furthermore, its interaction with glial NRCAM enhances its binding affinity with axonal NFASC. Gliomedin's intricate involvement underscores its significance in the structural integrity and functional organization of nodes of Ranvier.

Biological Activity

Data is not available.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q6ZMI3-2 (M1-Q427)

Gene ID
Molecular Construction
N-term
hFc
Gliomedin (M1-Q427)
Accession # Q6ZMI3-2
C-term
Synonyms
Gliomedin; GLDN; COLM
AA Sequence

MVDLCNSTKGICLTGPSGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPPGQKGEKGDKGDVSNDVLLAGAKGDQGPPGPPGPPGPPGPPGPPGSRRAKGPRQPSMFNGQCPGETCAIPNDDTLVGKADEKASEHHSPQAESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFKDQPSLLNGSYTFIHLPYYFHGCGHVVYNNSLYYHKGGSNTLVRFEFGQETSQTLKLENALYFDRKYLFANSKTYFNLAVDEKGLWIIYASSVDGSSILVAQLDERTFSVVQHVNTTYPKSKAGNAFIARGILYVTDTKDMRVTFAFDLLGGKQINANFDLRTSQSVLAMLAYNMRDQHLYSWEDGHLMLYPVQFLSTTLNQ

Molecular Weight

95-112 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Gliomedin Protein, Human (HEK293, N-hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Gliomedin Protein, Human (HEK293, N-hFc)
Cat. No.:
HY-P76363A
Quantity:
MCE Japan Authorized Agent: