GLIPR1 Protein, Human (HEK293, His)

GLIPR1 Protein is a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. It may function as a tumor inducer or a tumor suppressor. GLIPR1 promotes cell survival, growth, chemoresistance, and metastasis of glioma by multiple mechanisms, including the activation of STAT3 and CXCR4 signaling. GLIPR1 Protein, Human (HEK293, His) is the recombinant human-derived GLIPR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Glioma pathogenesis-related protein 1 (GLIPR1) is a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. GLIPR1 is initially identified in glioblastoma. GLIPR1 promotes proliferation, metastasis and 5-fluorouracil resistance in hepatocellular carcinoma by activating the PI3K/PDK1/ROCK1 pathway. GLIPR1 promotes cell survival, growth, chemoresistance, and metastasis of glioma by multiple mechanisms. GLIPR1 can also mediate the role of signal transducer and activator of transcription 3 (STAT3) in regulating the glioma epithelial-mesenchymal transition by increasing the expression of IL-6 which in turn activates STAT3 pathway. GLIPR1 has been found functioning as a tumor suppressor in prostate cancer, lung cancer, bladder cancer, and osteosarcoma via inducing cell cycle arrest, apoptosis, inhibiting key oncogenic drivers including c-Myc and TPX2, as well as triggering other tumor suppressors such as p53^[1][2][3][4].

Human

HEK293

C-6*His

P48060-1 (A22-R232)

11010  [NCBI]

ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR

Approximately 29.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.