1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. GLP-1
  5. GLP-1/GCG Protein, Human (HEK293, His)

GLP-1 and GCG are two proteins derived from the same precursor protein, which is encoded by the GCG-glucagon gene. The GCG protein is a counterregulatory hormone to insulin, playing a crucial role in glucose metabolism by increasing gluconeogenesis and reducing glycolysis to regulate blood glucose levels. GLP-1 protein, secreted by intestinal endocrine cells, promotes insulin secretion, regulates gastrointestinal motility, and inhibits the secretion of GCG protein. GLP-1/GCG protein, Human (HEK293, His), is a recombinant GLP-1/GCG protein expressed by HEK293 cells, with a His tag at the C-terminus, and is composed of 160 amino acids (R21-K180).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE GLP-1/GCG Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GLP-1 and GCG are two proteins derived from the same precursor protein, which is encoded by the GCG-glucagon gene. The GCG protein is a counterregulatory hormone to insulin, playing a crucial role in glucose metabolism by increasing gluconeogenesis and reducing glycolysis to regulate blood glucose levels. GLP-1 protein, secreted by intestinal endocrine cells, promotes insulin secretion, regulates gastrointestinal motility, and inhibits the secretion of GCG protein. GLP-1/GCG protein, Human (HEK293, His), is a recombinant GLP-1/GCG protein expressed by HEK293 cells, with a His tag at the C-terminus, and is composed of 160 amino acids (R21-K180)[1][2][3][4][5][6][7][8][9][10].

Background

GCG protein, also known as glucagon, is secreted by pancreatic α-cells and plays an important role in glucose metabolism and homeostasis. As a counterregulatory hormone to insulin, GCG protein counteracts the glucose-lowering effects of insulin when blood glucose levels drop, helping to maintain glucose balance in the body by raising blood sugar levels. In diabetes, GCG protein plays a key role in initiating and maintaining hyperglycemic conditions. Beyond regulating glucose metabolism, GCG protein also participates in lipid metabolism regulation[1][2][3].
GLP-1 protein is a hormone secreted by the intestine, and it plays a significant role in regulating blood glucose levels and maintaining gastrointestinal function.
Blood Glucose Regulation: GLP-1 protein enhances the glucose sensitivity of pancreatic β-cells by binding to receptors on their surface, leading to increased insulin secretion when blood glucose levels are high. Additionally, GLP-1 protein can promote the regeneration of islet cells and the proliferation of pancreatic β-cells, while possibly inhibiting β-cell apoptosis, thereby protecting islet function[4].
Gastrointestinal Function: GLP-1 protein helps maintain normal gastrointestinal function by inhibiting the secretion of GCG protein. It also enhances the uptake, utilization, and storage of glucose in peripheral tissues by regulating satiety. Moreover, GLP-1 protein promotes the growth of intestinal epithelium, contributing to intestinal health[5].
In addition, GLP-1 protein can regulate the hypothalamic-pituitary axis (HPA) by influencing the secretion of LH, TSH, CRH, oxytocin, and antidiuretic hormone[5].
Anti-inflammatory Effects: GLP-1 protein has anti-inflammatory effects on the islets and adipose tissues by reducing the production of inflammatory cytokines and the infiltration of immune cells into tissues. Furthermore, GLP-1 protein has shown anti-inflammatory effects in various chronic inflammatory diseases, including type 1 and type 2 diabetes, atherosclerosis, neurodegenerative diseases, non-alcoholic fatty liver disease, and diabetic nephropathy[6].

In Vitro

The GCG protein (Human) (100 nM, 1 hour) can enhance insulin secretion by binding to the GCG protein receptor on pancreatic β-cells under the stimulation of physiological glucose concentrations (5 mM)[7].
When pancreatic α-cells are exposed to GLP-1 protein (Human) (100 nM, 72 hours) for an extended period, the GLP-1 protein (Human) promotes the synthesis and release of GLP-1 by stimulating the transcription factor Pax6 and the protein convertase PC1/3 in pancreatic α-cells[8].

In Vivo

The GCG protein (Human) (150 μg/kg, intraperitoneally, once daily for 5 days) can stimulate thermogenesis in brown adipose tissue in Sprague-Dawley rats[9].
The GCG protein (Human) (0.3 μg/kg and 0.6 μg/kg, i.p., single dose; 0.6 μg/kg, s.c., single dose) significantly increases glucose levels in female farm pigs. Compared to subcutaneous injection, intraperitoneal administration induces a more rapid rise in blood glucose levels[10].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P01275 (R21-K180)

Gene ID
Molecular Construction
N-term
GLP-1 (R21-K180)
Accession # P01275
6*His
C-term
Synonyms
rHuPro-glucagon/GCG, His ; Glucagon; Glicentin; Glicentin-Related Polypeptide; GRPP; Oxyntomodulin; OXM; OXY; Glucagon; Glucagon-Like Peptide 1; GLP-1; Incretin Hormone; Glucagon-like Peptide 1; GLP-1; Glucagon-Like Peptide 2; GLP-2; GCG
AA Sequence

RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Molecular Weight

Approximately 19-21 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, 50% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

GLP-1/GCG Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1/GCG Protein, Human (HEK293, His)
Cat. No.:
HY-P70239
Quantity:
MCE Japan Authorized Agent: