1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST)

Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST)

Cat. No.: HY-P700381
Handling Instructions Technical Support

The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST) is the recombinant human-derived Glutathione S-transferase kappa 1/GSTK1 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST) is the recombinant human-derived Glutathione S-transferase kappa 1/GSTK1 protein, expressed by E. coli , with N-GST labeled tag.

Background

GSTK1 (Glutathione S-transferase kappa 1) is an enzyme that belongs to the glutathione S-transferase family and is involved in the catalysis of glutathione conjugation to both exogenous and endogenous compounds. Its significant glutathione conjugating activity is particularly notable with the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). This enzymatic activity suggests a role for GSTK1 in detoxification processes, where it facilitates the conjugation of glutathione to various xenobiotic and endogenous compounds, aiding in their elimination from the cell.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9Y2Q3-1 (G2-L226)

Gene ID
Molecular Construction
N-term
GST
GSTK1 (G2-L226)
Accession # Q9Y2Q3-1
C-term
Synonyms
Glutathione S-transferase kappa 1; GST 13-13; GSTK1-1; Glutathione S-transferase subunit 13
AA Sequence

GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Molecular Weight

52.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST)
Cat. No.:
HY-P700381
Quantity:
MCE Japan Authorized Agent: