GSTP1 Protein, Human

Glutathione S-transferase P (GSTP1) is a member of GSTs family and plays an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 enables JUN kinase binding activity; glutathione transferase activity; and kinase regulator activity and is involved in negative regulation of cell population proliferation, intracellular signal transduction and macromolecule metabolic process as well. GSTP1 Protein, Human is the recombinant human-derived GSTP1 protein, expressed by E. coli , with tag free. The total length of GSTP1 Protein, Human is 210 a.a., with molecular weight of ~23.66 kDa.

Glutathione S-transferase P (GSTP1) is a member of GSTs family, which are a group of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione.
GSTP1 enables JUN kinase binding activity; glutathione transferase activity; and kinase regulator activity. GSTP1 is also involved in negative regulation of cell population proliferation, intracellular signal transduction and macromolecule metabolic process. GSTP1 is part of protein-containing complex, and is implicated in several diseases, including brain disease (multiple), carcinoma (multiple), hematologic cancer (multiple), reproductive organ cancer (multiple), and respiratory system disease (multiple) ^[1][2][3].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

Tag Free

AAH10915.1 (M1-Q210)

2950  [NCBI]

MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Approximately 23.66 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.