1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GSTP1 Protein, Human

Glutathione S-transferase P (GSTP1) is a member of GSTs family and plays an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 enables JUN kinase binding activity; glutathione transferase activity; and kinase regulator activity and is involved in negative regulation of cell population proliferation, intracellular signal transduction and macromolecule metabolic process as well. GSTP1 Protein, Human is the recombinant human-derived GSTP1 protein, expressed by E. coli , with tag free. The total length of GSTP1 Protein, Human is 210 a.a., with molecular weight of ~23.66 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Glutathione S-transferase P (GSTP1) is a member of GSTs family and plays an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. GSTP1 enables JUN kinase binding activity; glutathione transferase activity; and kinase regulator activity and is involved in negative regulation of cell population proliferation, intracellular signal transduction and macromolecule metabolic process as well. GSTP1 Protein, Human is the recombinant human-derived GSTP1 protein, expressed by E. coli , with tag free. The total length of GSTP1 Protein, Human is 210 a.a., with molecular weight of ~23.66 kDa.

Background

Glutathione S-transferase P (GSTP1) is a member of GSTs family, which are a group of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione.
GSTP1 enables JUN kinase binding activity; glutathione transferase activity; and kinase regulator activity. GSTP1 is also involved in negative regulation of cell population proliferation, intracellular signal transduction and macromolecule metabolic process. GSTP1 is part of protein-containing complex, and is implicated in several diseases, including brain disease (multiple), carcinoma (multiple), hematologic cancer (multiple), reproductive organ cancer (multiple), and respiratory system disease (multiple) [1][2][3].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

AAH10915.1 (M1-Q210)

Gene ID
Molecular Construction
N-term
GSTP1 (M1-Q210)
Accession # AAH10915.1
C-term
Synonyms
rHuGlutathione S-transferase P/GSTP1; Glutathione S-transferase P; GSTP1; GST class-pi; GSTP1-1; FAEES3; GST3;
AA Sequence

MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Molecular Weight

Approximately 23.66 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

GSTP1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GSTP1 Protein, Human
Cat. No.:
HY-P70150
Quantity:
MCE Japan Authorized Agent: