GNMT Protein, Human (His)

Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.

Glycine N-methyltransferase (GNMT) is an enzyme that catalyzes the methylation of glycine using S-adenosylmethionine (AdoMet) as a methyl donor, resulting in the formation of N-methylglycine (sarcosine) and S-adenosylhomocysteine (AdoHcy). This reaction is crucial in the regulation of methyl group metabolism, as GNMT plays a key role in maintaining the balance between S-adenosyl-L-methionine and S-adenosyl-L-homocysteine levels. The enzyme is involved in the regulation of one-carbon metabolism and contributes to the control of the cellular methylation potential. The binding of 5-methyltetrahydrofolate is implicated in modulating the activity of GNMT, highlighting its role in coordinating methyl group utilization and homeostasis.

Human

E. coli

N-6*His

Q14749 (M1-D295)

27232  [NCBI]

MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

31&80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.