GPR56 Protein, Human (HEK293, His)

GPR56, a cell adhesion receptor, mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. It acts as a receptor for collagen III (COL3A1), influencing cortical development and hematopoietic stem cell maintenance. Additionally, GPR56 plays a pivotal role in cancer progression by inhibiting angiogenesis via PRKCA-mediated signaling and is essential for testis development. GPR56 Protein, Human (HEK293, His) is the recombinant human-derived GPR56 protein, expressed by HEK293 , with C-His labeled tag. The total length of GPR56 Protein, Human (HEK293, His) is 317 a.a., with molecular weight of 45-70 kDa.

GPR56 Protein functions as a receptor pivotal in cell adhesion and likely involved in cell-cell interactions. It plays a crucial role in mediating cell matrix adhesion during the development of neurons and hematopoietic stem cells. In the developing brain, GPR56 acts as a receptor for collagen III/COL3A1, contributing to the regulation of cortical development and playing a specific role in maintaining pial basement membrane integrity and cortical lamination. The interaction with the COL3A1 ligand inhibits neuronal migration and activates the RhoA pathway through coupling to GNA13 and possibly GNA12. Additionally, GPR56 is implicated in the maintenance of hematopoietic stem cells and/or leukemia stem cells within the bone marrow niche. Notably, GPR56 assumes a critical role in cancer progression, exhibiting a dual function by inhibiting VEGFA production and angiogenesis through a PRKCA-mediated signaling pathway, as well as activating VEGFA production to promote angiogenesis. Moreover, GPR56 proves essential in testis development, highlighting its diverse and significant contributions to various cellular processes.

Human

HEK293

C-His

Q9Y653-2/NP_958933.1 (R26-V342)

9289  [NCBI]

RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNV

45-70 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.