1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Adhesion GPCRs
  5. Adhesion G Protein-Coupled Receptor G1 (GPR56)
  6. GPR56 Protein, Human (HEK293, His)

GPR56, a cell adhesion receptor, mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. It acts as a receptor for collagen III (COL3A1), influencing cortical development and hematopoietic stem cell maintenance. Additionally, GPR56 plays a pivotal role in cancer progression by inhibiting angiogenesis via PRKCA-mediated signaling and is essential for testis development. GPR56 Protein, Human (HEK293, His) is the recombinant human-derived GPR56 protein, expressed by HEK293 , with C-His labeled tag. The total length of GPR56 Protein, Human (HEK293, His) is 317 a.a., with molecular weight of 45-70 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GPR56, a cell adhesion receptor, mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. It acts as a receptor for collagen III (COL3A1), influencing cortical development and hematopoietic stem cell maintenance. Additionally, GPR56 plays a pivotal role in cancer progression by inhibiting angiogenesis via PRKCA-mediated signaling and is essential for testis development. GPR56 Protein, Human (HEK293, His) is the recombinant human-derived GPR56 protein, expressed by HEK293 , with C-His labeled tag. The total length of GPR56 Protein, Human (HEK293, His) is 317 a.a., with molecular weight of 45-70 kDa.

Background

GPR56 Protein functions as a receptor pivotal in cell adhesion and likely involved in cell-cell interactions. It plays a crucial role in mediating cell matrix adhesion during the development of neurons and hematopoietic stem cells. In the developing brain, GPR56 acts as a receptor for collagen III/COL3A1, contributing to the regulation of cortical development and playing a specific role in maintaining pial basement membrane integrity and cortical lamination. The interaction with the COL3A1 ligand inhibits neuronal migration and activates the RhoA pathway through coupling to GNA13 and possibly GNA12. Additionally, GPR56 is implicated in the maintenance of hematopoietic stem cells and/or leukemia stem cells within the bone marrow niche. Notably, GPR56 assumes a critical role in cancer progression, exhibiting a dual function by inhibiting VEGFA production and angiogenesis through a PRKCA-mediated signaling pathway, as well as activating VEGFA production to promote angiogenesis. Moreover, GPR56 proves essential in testis development, highlighting its diverse and significant contributions to various cellular processes.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9Y653-2/NP_958933.1 (R26-V342)

Gene ID
Molecular Construction
N-term
GPR56 (R26-V342)
Accession # Q9Y653-2/NP_958933.1
His
C-term
Synonyms
Adhesion G-protein coupled receptor G1; ADGRG1 NT; ADGRG1; GPR56; TM7LN4; TM7XN1
AA Sequence

RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNV

Molecular Weight

45-70 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GPR56 Protein, Human (HEK293, His)
Cat. No.:
HY-P75796
Quantity:
MCE Japan Authorized Agent: