GSTM5 Protein, Human (N-His)

GSTM5 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles, crucial for cellular detoxification. Its enzymatic activity, addressing both exogenous and endogenous compounds, is essential for eliminating harmful substances and maintaining cellular homeostasis, highlighting GSTM5's protective role against toxic insults. GSTM5 Protein, Human (N-His) is the recombinant human-derived GSTM5 protein, expressed by E. coli , with N-6*His labeled tag.

GSTM5 protein plays a pivotal role in the cellular process of conjugating reduced glutathione to a broad spectrum of hydrophobic electrophiles, both originating from the cellular environment and generated endogenously. This enzymatic activity is fundamental for the detoxification and elimination of various harmful compounds within the cell, showcasing the essential role of GSTM5 in maintaining cellular homeostasis and protecting against potential toxic insults.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P46439 (M1-K218)

2949  [NCBI]

MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK

Approximately 27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01%Tween80, pH 7.4 or PBS, pH 7.4.

Data is not available.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.