1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GSTT2B Protein, Human (HEK293, His)

GSTT2B protein, crucial in conjugating reduced glutathione to hydrophobic electrophiles, is essential for cellular detoxification. Its sulfatase activity adds to its multifunctional role in cellular processes. The combined glutathione conjugation and sulfatase function underscore GSTT2B's versatility in handling diverse substrates, emphasizing its significance in cellular detoxification mechanisms. GSTT2B Protein, Human (HEK293, His) is the recombinant human-derived GSTT2B protein, expressed by HEK293 , with C-His labeled tag. The total length of GSTT2B Protein, Human (HEK293, His) is 244 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GSTT2B protein, crucial in conjugating reduced glutathione to hydrophobic electrophiles, is essential for cellular detoxification. Its sulfatase activity adds to its multifunctional role in cellular processes. The combined glutathione conjugation and sulfatase function underscore GSTT2B's versatility in handling diverse substrates, emphasizing its significance in cellular detoxification mechanisms. GSTT2B Protein, Human (HEK293, His) is the recombinant human-derived GSTT2B protein, expressed by HEK293 , with C-His labeled tag. The total length of GSTT2B Protein, Human (HEK293, His) is 244 a.a..

Background

GSTT2B protein plays a crucial role in the conjugation of reduced glutathione to a diverse array of hydrophobic electrophiles, both exogenous and endogenous. This enzymatic activity is vital for the detoxification process within cells. Additionally, GSTT2B exhibits sulfatase activity, further contributing to its multifunctional role in cellular processes. The combined activities of glutathione conjugation and sulfatase function highlight the versatility of GSTT2B in handling various substrates and underline its significance in cellular detoxification mechanisms.

Biological Activity

Measure the activity of peroxidase by detecting the decrease in NADPH. The specific activity is 3550.754 pmol/min/μg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P0CG29 (M1-P244)

Gene ID

653689

Molecular Construction
N-term
GSTT2B (M1-P244)
Accession # P0CG29
His
C-term
Synonyms
Glutathione S-transferase theta-2B; GST class-theta-2; GSTT2B; GSTT2
AA Sequence

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARI

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GSTT2B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GSTT2B Protein, Human (HEK293, His)
Cat. No.:
HY-P75802
Quantity:
MCE Japan Authorized Agent: