HB-EGF Protein, Human

HB-EGF Protein, Human is a member of the epidermal growth factor (EGF) family of growth factors that stimulate growth and differentiation.

Heparin-binding EGF-like Growth Factor (HB-EGF) belongs to the EGF superfamily of peptide growth and differentiation factors. HB-EGF activates two EGF receptor subtypes, HER1 and HER4 and binds to cell surface HSPG. The transmembrane form of HB-EGF is a juxtacrine growth and adhesion factor and is uniquely the receptor for diphtheria toxin. HB-EGF gene expression is highly regulated, for example by cytokines, growth factors, and transcription factors such as MyoD. HB-EGF has been implicated as a participant in a variety of normal physiological processes such as blastocyst implantation and wound healing, and in pathological processes such as tumor growth, SMC hyperplasia and atherosclerosis^[1].

The ED₅₀ is <0.75 ng/mL as measured by 3T3 cells.

Human

E. coli

Tag Free

Q99075 (D63-L148)

1839  [NCBI]

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

9-14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Raab G, et al. Heparin-binding EGF-like growth factor. Biochim Biophys Acta. 1997 Dec 9;1333(3):F179-99.  [Content Brief]