1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. HGPRT Protein, Human (His)

HGPRT Protein, Human (His)

Cat. No.: HY-P70227
SDS COA Handling Instructions

HGPRT proteins play a key role in purine metabolism, promoting the conversion of guanine to guanosine monophosphate and hypoxanthine to inosine monophosphate. Through its enzymatic activity, HGPRT transfers the 5-phosphate ribosyl group from 5-phosphate ribose pyrophosphate to purine, making a significant contribution to the purine salvage pathway. HGPRT Protein, Human (His) is the recombinant human-derived HGPRT protein, expressed by E. coli , with N-6*His labeled tag. The total length of HGPRT Protein, Human (His) is 218 a.a., with molecular weight of ~30.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HGPRT proteins play a key role in purine metabolism, promoting the conversion of guanine to guanosine monophosphate and hypoxanthine to inosine monophosphate. Through its enzymatic activity, HGPRT transfers the 5-phosphate ribosyl group from 5-phosphate ribose pyrophosphate to purine, making a significant contribution to the purine salvage pathway. HGPRT Protein, Human (His) is the recombinant human-derived HGPRT protein, expressed by E. coli , with N-6*His labeled tag. The total length of HGPRT Protein, Human (His) is 218 a.a., with molecular weight of ~30.0 kDa.

Background

The HGPRT protein, or hypoxanthine-guanine phosphoribosyltransferase, is a key enzyme that plays a central role in the generation of purine nucleotides through the purine salvage pathway. HGPRT catalyzes the conversion of guanine to guanosine monophosphate (GMP) and hypoxanthine to inosine monophosphate (IMP). This enzymatic activity involves the transfer of the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine substrates. By facilitating these reactions, HGPRT ensures the efficient utilization of salvaged purines in the synthesis of essential nucleotides, contributing to cellular processes such as DNA and RNA synthesis. The purine salvage pathway, with HGPRT at its core, is crucial for maintaining purine nucleotide pools and overall nucleotide homeostasis in the cell (

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P00492 (M1-A218)

Gene ID
Molecular Construction
N-term
6*His
HGPRT (M1-A218)
Accession # P00492
C-term
Synonyms
rHuHypoxanthine-guanine phosphoribosyltransferase/HGPRT, His; Hypoxanthine-Guanine Phosphoribosyltransferase; HGPRT; HGPRTase; HPRT1; HPRT
AA Sequence

MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 250 mM NaCl, 50% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

HGPRT Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HGPRT Protein, Human (His)
Cat. No.:
HY-P70227
Quantity:
MCE Japan Authorized Agent: