HGPRT Protein, Human (His)

HGPRT proteins play a key role in purine metabolism, promoting the conversion of guanine to guanosine monophosphate and hypoxanthine to inosine monophosphate. Through its enzymatic activity, HGPRT transfers the 5-phosphate ribosyl group from 5-phosphate ribose pyrophosphate to purine, making a significant contribution to the purine salvage pathway. HGPRT Protein, Human (His) is the recombinant human-derived HGPRT protein, expressed by E. coli , with N-6*His labeled tag. The total length of HGPRT Protein, Human (His) is 218 a.a., with molecular weight of ~30.0 kDa.

The HGPRT protein, or hypoxanthine-guanine phosphoribosyltransferase, is a key enzyme that plays a central role in the generation of purine nucleotides through the purine salvage pathway. HGPRT catalyzes the conversion of guanine to guanosine monophosphate (GMP) and hypoxanthine to inosine monophosphate (IMP). This enzymatic activity involves the transfer of the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine substrates. By facilitating these reactions, HGPRT ensures the efficient utilization of salvaged purines in the synthesis of essential nucleotides, contributing to cellular processes such as DNA and RNA synthesis. The purine salvage pathway, with HGPRT at its core, is crucial for maintaining purine nucleotide pools and overall nucleotide homeostasis in the cell (

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P00492 (M1-A218)

3251  [NCBI]

MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 250 mM NaCl, 50% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.